SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013987493.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013987493.1.97760
Domain Number 1 Region: 738-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000234
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 633-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000041
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 206-228,300-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000102
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 4 Region: 540-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000157
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 675-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000211
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 6 Region: 594-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000109
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 7 Region: 128-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000119
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013987493.1.97760
Sequence length 879
Comment PREDICTED: zinc finger protein 11-like [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MESTDLEREDAPSSLSGYANGEIMTLEISDVSPDLLVLEVKDSNLPESIHGSLDMEMNAD
FHEDDDDGHGFANMELQFFPCDACEASFTSEPELEQHFISSHSICDVASERGRQKAKSME
TEGVSPLHTCMTCGKVFKYLTSFRKHEETHIKALYTCKTCGKEFKYLTSFTKHKDTHVVP
RTRGRGKGKSIKAVGLSVNKKMKGLHTCKHCGKEFKYVTSFIKHEKTHRITITKRSRKKQ
RKLSTSKIIIRLEGNRKDATETHIRANKKNRKNSEDTKDQNDQDACILISSAEQQTPDTK
RSPPFPCLDCGKIFKFFKSYQKHQKRHAWAQGKSEGVPPKQKHGPEAKENIRCPVCGRAF
NKQTTRTKHQNTYHLKNNLHKNTNILTCCECDRHFEKADLFQKHKCFHLRKQVKAFIEAG
RVSQDGDVFYCQLCVLQLTSGLEFENHARDIHPDQYRKILKAVGNIIKDTLKGLQTRRVD
NQSTSQEEPEIDLNSVGETEEDGSRQFICKNCGEYFIYRVSFTFCGKCLKDRKDRRKASK
VYHCEECGQHFGRKDHLKRHSYSHSGSSFVCSDCGVKFRDPGELRTHEKTHQVRNHACQR
CEKRFEQEEELMLHREIAHPEPGGYTCHRCGKTFSTVKNLGKHRMIHSDKTPHVCSNCGT
KFKRREHLRRHESLHTNEKPHLCHCCGDTFGRKEDLNTHLGKMHIISRRFLCKACGTSFK
DRNALRRHRYHAHTKAGKVFQCEACGLSFGRADHLKRHQHTHSTERPFSCSMCYKVFHRA
DNLKKHERNHRNKWLEYLNRHKTPKQESRVSESSKWKLRRSEASALLKLIQSHSKQQQHT
CYVCKKTFRGIYYLKRHRLLNCCVQRNKMMDSFRYGTVK
Download sequence
Identical sequences A0A1S3L949
XP_013987493.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]