SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014000198.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014000198.1.97760
Domain Number 1 Region: 489-655
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 5.62e-73
Family A middle domain of Talin 1 0.0000000971
Further Details:      
 
Domain Number 2 Region: 775-910
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.08e-52
Family I/LWEQ domain 0.00000113
Further Details:      
 
Domain Number 3 Region: 2315-2504
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.83e-49
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 4 Region: 686-804
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.89e-49
Family I/LWEQ domain 0.00000307
Further Details:      
 
Domain Number 5 Region: 1865-1993
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.12e-41
Family VBS domain 0.00000362
Further Details:      
 
Domain Number 6 Region: 1246-1382
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.65e-38
Family VBS domain 0.014
Further Details:      
 
Domain Number 7 Region: 196-309
Classification Level Classification E-value
Superfamily Second domain of FERM 7.98e-35
Family Second domain of FERM 0.00000101
Further Details:      
 
Domain Number 8 Region: 310-400
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 9 Region: 1096-1228
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.39e-22
Family VBS domain 0.05
Further Details:      
 
Domain Number 10 Region: 1489-1576
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000589
Family I/LWEQ domain 0.0082
Further Details:      
 
Domain Number 11 Region: 2027-2152
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000001
Family VBS domain 0.015
Further Details:      
 
Domain Number 12 Region: 1717-1832
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000526
Family VBS domain 0.053
Further Details:      
 
Domain Number 13 Region: 942-1004
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000471
Family I/LWEQ domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014000198.1.97760
Sequence length 2563
Comment PREDICTED: talin-1 isoform X2 [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MVALSLKIGVGNVVKTMQFEPSTMVYDACRMIRERVPEAQLGQPNDYGLFLSDEDPKKGI
WLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIG
ITNYDEYSLVHDVVEEKKEEMTGTLTRRDKTLMRDDKKMEKLKQKLHTDDELNWLDHGRT
LREQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACDFA
GYQCQIQFGDHNETKHKPGFLDLKEFLPKEYIKNKGEKRIFQAHKNYQNMTEIEAKVSYV
KLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRW
AASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTM
LEDSVSPKKSTVLQQQFNKVGKVETGSVALPAIMRSGAGGPESFQMGSMPQAKQHITSGQ
MHRGHMPPLTSAQQALTGTINSSMQALQAAQASLEEFDTLPPLGTDAASQAWRKNKMDES
KHEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALME
DEGGNGNQLLGAAKNLACAVSDMLKTAQPANTEPRQNLLQAAGNVGQASGELLSHIGETD
ADPRFQFLGKGSFRGARRSVSTYSHMLDMLMQLAKAVANAAAALVLKAKNVAQKTEDSAL
QNRVIAAATQCALSTSQLVACTRVVAPTISSPVCQEQLIEAGKLVAKSVDGCVDASQGAT
SDEGLLKQVGAAATGVTHALNELLQHIKQYAHGGQPIGRHGEATDRILDVTENIFSSMGD
AGEMVRQARILAQATSDLVNAIKMDAEGESDLENSRKLLSAAKLLADATAKMVEAAKGAA
ANPDSEEQQQRLREAAEGLRMATNAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHA
ASSNKNPAAQQQLVQSCKVVADQIPQLVQGVRGSQSQPDSPSAQLTLIGAGQNFLLPGAK
MVTAAKATVPTIGDQASAMQLSQCAKNLATALAELRTAAQKAQEACGPLEIDNALTVVRG
LEKDMVEAKASAGDGKLKPLPGETLEKCSQDVGNSTKAVSSAIAQLLSEATQGNENYTGM
AARDVAQALRALASAARGVAATTADPQARNAMLDCAGDVMDKSANLIEETKRAIAKPGDP
DSQQRLAQVAKAVSQALNRSVNCLPGQRDVDNAIRTVGEASKKLLANSFPPSGKSFQEAQ
VNLNQAAAGLNQSANELVQSSRGTTQDLAKATGKFGHDFGEFLEAGVDMAGQSQNKENQT
QVVSNLKTISMSSSKLLLAAKVLSTDPNSPNLKNQLAAAARAVTDSINQLITMCTQQAPG
QKECDNALRELETVRGMLENPTEAVSELSYFDCIDSVMENSKVLGEAMAGISHNAKNSNL
PEFGDSVSSGSKALCGLTEAAAQGAYLVGVSDPKSHAGQKGLVDPGQFARANQSIQMACQ
NLVDPACTQSQVLSAATIVAKHTSALCNACRLASSKTANPVAKRQFVQSAKEVANSTANL
VKSIKALDGAFNQQNREKCRVATGPLIEAVDNLTAFASNPEFASVPAQISAEGLAAMEPI
VAAAKTMLESSTGLIQTARSLAVNPKDPPKWSVLAGHSRTVSDSIKKLITNMRDKAPGQR
ECDEAIEVLNNCIREVDQASLAAISQQLTPREDISQEALHEQLAASVQEISNLIEPVAIA
ARSEASHLGHKVSQMVSYFEPLIMAAIGTASKIQSSQQQMAVLDQTKTLTESALQMLYTA
KEAGGNPKAAHTQEALEESVQMMKEAVDDLGATLSETASAAGALGGMVDSITAAINKMEE
SPAGEPDGSFVDYQTTMVKTAKAIAVTVQEMVTKSNTNPDDLGGLASELTNEFGELATEA
KYAAITAENDEIGSHIKKQVGELGFNCTGLVTKAGALQCSPNDSFTKKELIDSARKVSEK
VSHVLAALQAGNRGTQACITAASTVSGIIADLDTTIMFATAGTLNRENSETFADHREHIL
KTAKALVEDTKLLVSGAGASQERLAQAAQSSVITITKLADVVKLGAASLGAEDPETQVVL
INAVKDVAKALSDLISATKAAAGKPHDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEAT
KGTRGLEATIEHIKQELAVFSNGDPPPKTSTPEDFIRMTKGITQATAKAVAAGNSCRQED
VIATANLSRRAIADMLHSCKQAAYHPEVSKEVQSRALRYGNECAVGYLGLLEHVLVIIQK
PSHELKQQLANYSKRVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAA
RKLELLRPRTKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGACP
ANAVDDGQWSQGLISAARMVAAATSNLCEAANSAVQGHASEEKLVSSAKQVSASTAQLLV
ACKVKADQDSQTMKRLQAAGNAVKRASDSLVKAAQKAAFDAQDEQAVVVKSKMVGGIAQI
IAAQEEMLRKERELDEARKKLATIRQQQYKFLPSELREDGQEQ
Download sequence
Identical sequences A0A1S3MAI4
XP_014000198.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]