SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014000219.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014000219.1.97760
Domain Number 1 Region: 489-655
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 5.62e-73
Family A middle domain of Talin 1 0.0000000971
Further Details:      
 
Domain Number 2 Region: 754-889
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.89e-52
Family I/LWEQ domain 0.00000113
Further Details:      
 
Domain Number 3 Region: 660-783
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.84e-51
Family I/LWEQ domain 0.000002
Further Details:      
 
Domain Number 4 Region: 2294-2483
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.75e-49
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 5 Region: 1844-1972
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.12e-41
Family VBS domain 0.00000362
Further Details:      
 
Domain Number 6 Region: 1225-1361
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.49e-38
Family VBS domain 0.014
Further Details:      
 
Domain Number 7 Region: 196-309
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-35
Family Second domain of FERM 0.00000101
Further Details:      
 
Domain Number 8 Region: 310-400
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 9 Region: 1075-1207
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.24e-22
Family VBS domain 0.05
Further Details:      
 
Domain Number 10 Region: 1468-1555
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000576
Family I/LWEQ domain 0.0082
Further Details:      
 
Domain Number 11 Region: 2006-2131
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000001
Family VBS domain 0.015
Further Details:      
 
Domain Number 12 Region: 1696-1811
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000518
Family VBS domain 0.053
Further Details:      
 
Domain Number 13 Region: 921-983
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000471
Family I/LWEQ domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014000219.1.97760
Sequence length 2542
Comment PREDICTED: talin-1 isoform X4 [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MVALSLKIGVGNVVKTMQFEPSTMVYDACRMIRERVPEAQLGQPNDYGLFLSDEDPKKGI
WLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIG
ITNYDEYSLVHDVVEEKKEEMTGTLTRRDKTLMRDDKKMEKLKQKLHTDDELNWLDHGRT
LREQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACDFA
GYQCQIQFGDHNETKHKPGFLDLKEFLPKEYIKNKGEKRIFQAHKNYQNMTEIEAKVSYV
KLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRW
AASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTM
LEDSVSPKKSTVLQQQFNKVGKVETGSVALPAIMRSGAGGPESFQMGSMPQAKQHITSGQ
MHRGHMPPLTSAQQALTGTINSSMQALQAAQASLEEFDTLPPLGTDAASQAWRKNKMDES
KHEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALME
DEGGNGNQLLGAAKNLACAVSDMLKTAQPANTEPRQNLLQAAGNVGQASGELLSHIGETD
ADPRFQDMLMQLAKAVANAAAALVLKAKNVAQKTEDSALQNRVIAAATQCALSTSQLVAC
TRVVAPTISSPVCQEQLIEAGKLVAKSVDGCVDASQGATSDEGLLKQVGAAATGVTHALN
ELLQHIKQYAHGGQPIGRHGEATDRILDVTENIFSSMGDAGEMVRQARILAQATSDLVNA
IKMDAEGESDLENSRKLLSAAKLLADATAKMVEAAKGAAANPDSEEQQQRLREAAEGLRM
ATNAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNKNPAAQQQLVQSCKVVA
DQIPQLVQGVRGSQSQPDSPSAQLTLIGAGQNFLLPGAKMVTAAKATVPTIGDQASAMQL
SQCAKNLATALAELRTAAQKAQEACGPLEIDNALTVVRGLEKDMVEAKASAGDGKLKPLP
GETLEKCSQDVGNSTKAVSSAIAQLLSEATQGNENYTGMAARDVAQALRALASAARGVAA
TTADPQARNAMLDCAGDVMDKSANLIEETKRAIAKPGDPDSQQRLAQVAKAVSQALNRSV
NCLPGQRDVDNAIRTVGEASKKLLANSFPPSGKSFQEAQVNLNQAAAGLNQSANELVQSS
RGTTQDLAKATGKFGHDFGEFLEAGVDMAGQSQNKENQTQVVSNLKTISMSSSKLLLAAK
VLSTDPNSPNLKNQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRGMLENP
TEAVSELSYFDCIDSVMENSKVLGEAMAGISHNAKNSNLPEFGDSVSSGSKALCGLTEAA
AQGAYLVGVSDPKSHAGQKGLVDPGQFARANQSIQMACQNLVDPACTQSQVLSAATIVAK
HTSALCNACRLASSKTANPVAKRQFVQSAKEVANSTANLVKSIKALDGAFNQQNREKCRV
ATGPLIEAVDNLTAFASNPEFASVPAQISAEGLAAMEPIVAAAKTMLESSTGLIQTARSL
AVNPKDPPKWSVLAGHSRTVSDSIKKLITNMRDKAPGQRECDEAIEVLNNCIREVDQASL
AAISQQLTPREDISQEALHEQLAASVQEISNLIEPVAIAARSEASHLGHKVSQMVSYFEP
LIMAAIGTASKIQSSQQQMAVLDQTKTLTESALQMLYTAKEAGGNPKAAHTQEALEESVQ
MMKEAVDDLGATLSETASAAGALGGMVDSITAAINKMEESPAGEPDGSFVDYQTTMVKTA
KAIAVTVQEMVTKSNTNPDDLGGLASELTNEFGELATEAKYAAITAENDEIGSHIKKQVG
ELGFNCTGLVTKAGALQCSPNDSFTKKELIDSARKVSEKVSHVLAALQAGNRGTQACITA
ASTVSGIIADLDTTIMFATAGTLNRENSETFADHREHILKTAKALVEDTKLLVSGAGASQ
ERLAQAAQSSVITITKLADVVKLGAASLGAEDPETQVVLINAVKDVAKALSDLISATKAA
AGKPHDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRGLEATIEHIKQELAVFS
NGDPPPKTSTPEDFIRMTKGITQATAKAVAAGNSCRQEDVIATANLSRRAIADMLHSCKQ
AAYHPEVSKEVQSRALRYGNECAVGYLGLLEHVLVIIQKPSHELKQQLANYSKRVAGSVT
ELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAARKLELLRPRTKPKEADESLNF
EEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGACPANAVDDGQWSQGLISAARMVA
AATSNLCEAANSAVQGHASEEKLVSSAKQVSASTAQLLVACKVKADQDSQTMKRLQAAGN
AVKRASDSLVKAAQKAAFDAQDEQAVVVKSKMVGGIAQIIAAQEEMLRKERELDEARKKL
ATIRQQQYKFLPSELREDGQEQ
Download sequence
Identical sequences A0A1S3MB10
XP_014000219.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]