SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014000868.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014000868.1.97760
Domain Number 1 Region: 37-519
Classification Level Classification E-value
Superfamily Sema domain 1.16e-99
Family Sema domain 0.00074
Further Details:      
 
Domain Number 2 Region: 1387-1510,1676-1861
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-34
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 951-1023
Classification Level Classification E-value
Superfamily E set domains 0.00000000000293
Family Other IPT/TIG domains 0.039
Further Details:      
 
Domain Number 4 Region: 860-950
Classification Level Classification E-value
Superfamily E set domains 0.0000000000598
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 5 Region: 1043-1125
Classification Level Classification E-value
Superfamily E set domains 0.000000000535
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number 6 Region: 522-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000715
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014000868.1.97760
Sequence length 1900
Comment PREDICTED: plexin-D1-like [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MPPSEKIVVLIFGVLVLESSWNAQHSPWLASALQIQQAFASPNQTNNFVVDEVSRKVYLA
TVNMVYQLNRTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNFNKLLELDREQG
VLVVCGSVYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFRSH
GGNTRLLVGATYTGVGTTFFPKNHSKEDLRFENTPEIAIRSLNISDLSRLFTYDINPSED
NVFKIKQEVKQKNKLNFVHAFIQKTYSYIAINNDAKMGHKESQPNSILARICLDTENPRK
STSESRKLTESFIQMPLQCGYNGNIYNRLLSVHPAEIHSGTGEGLESYLFGVFTKSDRKS
ALCAFRFSDIEEEIRQGRRNCSNSPSSEVQVLDSVIQGSGAACVHKGNLVLQPEQLDCGA
AHLQHPLALQRPLRATPLFESLGLSSVAVDDVHHHTVVFLGTSTGRLRKLTLLKNLTVAN
QWALKLPGGESVHHIMTFDPIDRNYLYLMTSHHLLRVKVATCSQYRTCSDCLGAGDAHCG
WCTLESRCSIQRECAWGPLARFWIGMKEGPQQCPSMTLTPPEISLSTDIKDVGILINGSV
PDLVGSRVECDYGLGVATAATVHLDYGPAQIQTCPLLPRERYPNIPPGRDHLTVPVAIKV
NGTSVVSGSFVIYDCERTGAIHPKTACISCLSTRWRCYWDQDSHSCLSSKDDSKHSLLEN
AAFCPSLVAENVGPSPSGMTQNFTLFLVNVVQGEELECDFGNEQRYDSRWLEDSSGVKCP
GVTLTTVERSQVFQLSLRRKGHLDKYIDSPKPMTVEVYNCGVGIGDCSQCWGRENLGHLC
GWCDNSCRPRNDCQYMNSQCPDPEITKISPRSGPLEGGTLLTVQGRNMGHRAEVVEVSIG
MFPCTIIPDQYTVSVELVCVTGQAVDPTSDFVRITVIQKAMGVSKEVFSYLVPKLLSMEP
RKGSRSGGTRVTIKGEHLDTGSQIRVKVNGTQECTILTLTEDTIECTMPAALHTHTEAVS
VCVEFEYIPCQRSKLLTQYIYEKNPSISYIKPRQSYLSGGRTITVTGQGFHLVQSVTMEV
LDIGQAACKVQPPSMITCPSPTSSQSQQATVEFFLNGVLYTGDSPVFYGPGQEEEEEPHG
GHFLLEYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPSNLELAPEEYSVMIGSYPCDIS
FHNDQLFHCSINGSLGSSEGELPVTVQVGNFQRIIAKVQLGGSELAIVVSIVVCCVLLLL
CTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNSSQG
IPFLEYKQFVTRTFFPKMCSDYERSLVQPVYENNTLGPRALPETHPLLQDWQPSNTAKPN
MEEGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKD
LLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQI
NKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLAVRVMNTDTICQVKD
KILDAFYKNLPFSQWPQAEDVDLEWFASGSNSRILQDLDNTSVMEDGRKKLNTVTHYQIP
EGASFAMSMKDKRDNTLGRAKDLDTEKYVHLVLPHDELFENKKSHRQSHRKKVLPEIYLT
RLLSTKGTLQKFLDDLFQAILSIPAERPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTN
SLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYA
KEIPEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKKYR
NQVVSALESNPTAKRTQLHHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences A0A1S3MCD7
XP_014000868.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]