SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014010702.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014010702.1.97760
Domain Number 1 Region: 2-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000262
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 2 Region: 29-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000578
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 112-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 4 Region: 71-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014010702.1.97760
Sequence length 180
Comment PREDICTED: fibropellin-1-like, partial [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MPCQNGAVCVDGVDLYHCFCPAGFEGLNCEINYDECVYGFCANNSTCVDLVADYGCICPV
GFVGKNCSTPVIECASGDRTKCKNGGTCYIFAGVVHCTCPPGWGADDCSAPVNQCVLNPC
DPEGTLFCEELPNGFKCVCQHGYMGRLCEIPISHCVDGLCHPRIKVCGSTERIQVPLFTR
Download sequence
Identical sequences A0A1S3N5N7
XP_014010702.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]