SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014057805.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014057805.1.97760
Domain Number 1 Region: 117-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.19e-33
Family cAMP-binding domain 0.000000672
Further Details:      
 
Domain Number 2 Region: 246-370
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-31
Family cAMP-binding domain 0.000000536
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.49e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014057805.1.97760
Sequence length 379
Comment PREDICTED: cAMP-dependent protein kinase type I-alpha regulatory subunit-like isoform X2 [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MASGSTSSEEERSLRECELYVQKHNIQQLLKDCIVQLCTSRPDRPMAFLREYFERLEKEE
AKQNLQLQKSNSRSDSREDEVSPPMNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDY
KTMAALAKAIEKNVLFAHLDDNERSDIFDAMFSVTYIAGETVIQQGDEGDNFYVIDQGEM
DVYVNNEWVTNIGEGGSFGELALIYGTPRAATVRAKSNVKLWGIDRDSYRRILMGSTLRK
RKMYEEFLSKVSILESLDKWERLTVADALETVQFEDGQEIVVQGEPGDEFFIILEGSAAV
LQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVSRGPLKCVKLDRPRFERVLGPC
SDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A1S3S039
XP_014057805.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]