SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014066202.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014066202.1.97760
Domain Number 1 Region: 98-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000067
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 2 Region: 14-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000355
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 57-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 4 Region: 173-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000332
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014066202.1.97760
Sequence length 235
Comment PREDICTED: fibropellin-3-like, partial [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
CLPGFSGKSCEVVIDYCSLLSVNCLHQGLCLSVIGGYNCLCAPGWIGEFCQYGGNACLIY
PDSCMNGATCITSSQPTAPPQYRCICSPGYTGPHCETEINQCFSNPCLHNGTCLDSVGFY
KCSCPPGFLGQKCEVDVDACTLPNTTCPRNTHCLDLPDGLKYTCRLLCPQNIQLCANGGR
CVLNNASSSTCVCAPGWAGRNCRLNINDCVQHWCQNGATCVDEIDGYREMVLREC
Download sequence
Identical sequences A0A1S3SPD0
XP_014066202.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]