SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014075393.1.79200 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014075393.1.79200
Domain Number 1 Region: 175-323
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000143
Family UAS domain 0.08
Further Details:      
 
Domain Number 2 Region: 399-504
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000284
Family UBX domain 0.02
Further Details:      
 
Domain Number 3 Region: 12-55
Classification Level Classification E-value
Superfamily UBA-like 0.000000105
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014075393.1.79200
Sequence length 517
Comment hypothetical protein COCC4DRAFT_147714 [Bipolaris maydis ATCC 48331]; AA=GCF_000354255.1; RF=representative genome; TAX=665024; STAX=5016; NAME=Bipolaris maydis ATCC 48331; strain=ATCC 48331; AL=Scaffold; RT=Major
Sequence
MADTGVDIGSLSPDQQAALQQYTAVTDQAVEAAIPLLQRAQWNVNIAVTRFFDGEPTEDP
VAVAAAQQPPRDTRRQETLLNGFGAPRSSTSSGRRPMIEPAPRVVPQPESQVTTQVPLVL
AIFFAPFSLVYSLFSKSFRLLGWIFPFLPRVWGRLTASNINTPASQRSTSGRRPLNPRDT
AARFIREFEEEYGSHNLPFFESGYAQAFDLAKKNLQFLMVVLISPEHDETSSFIRDTLLA
PEVVEFVRNPDNNIILWAGNVQDSEAYQVSAALSCTKFPFTGLIVHTPQVSSTAMGIATR
VTGPTPPQQYVAKLRTAMQQHTEPLNRVRSQRAEQQATRSIREQQNSAYERSLAADREKA
RKKKEEAERKAREEKEALEREQAIERYAQNLEQWRKWRAASIPPEPDTSETNVVRISLRM
PDAQRVVRKFAADADIEELYAFVECYDILQSGNEAGEKVEEPKDFEHEYKFQLVSPMPRE
VYDLKAGGSIKQRIGRSGNLIVERTDLEEEDDDDNEE
Download sequence
Identical sequences M2TB63 N4WM81
XP_014075393.1.79200 jgi|CocheC5_1|86435|estExt_Genewise1.C_80393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]