SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014078139.1.79200 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014078139.1.79200
Domain Number 1 Region: 416-577
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.53e-24
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 306-406
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000294
Family Rhamnogalacturonase B, RhgB, middle domain 0.026
Further Details:      
 
Domain Number 3 Region: 115-302
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000129
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014078139.1.79200
Sequence length 579
Comment polysaccharide lyase family 4 protein [Bipolaris maydis ATCC 48331]; AA=GCF_000354255.1; RF=representative genome; TAX=665024; STAX=5016; NAME=Bipolaris maydis ATCC 48331; strain=ATCC 48331; AL=Scaffold; RT=Major
Sequence
MKSLLPLLVYGGAGVVASASAYSHHDSSPQQPKSFFRQIGNATWILGNELWNVTQNAQYA
TKLMFKGKDRVGEAVGHYVSYNGAASDLRWTTASIASSGPNWLDIRFRAVEGDFHWVLHD
DLAGAYQYFINRALPTLGEFRTLWRLSNASFPNASTNVKSGPLPPFSAYQNPTKVQDETW
QKSDGTFLTKYDWAAFLREQTAYGVWGDEVGSWYLHAGKDYLNGDQLKQELMLHRESQTG
DTVQLNMLHGTHYQASSRDSFAAGNANARVWGPWLWYLNGGSRQDAVARWEKEEKEWPYA
WFENTAYQSRGAVQGKLLLSDGRPAAGAAVFLGDNRNETVSTLDQGQNYYYTAYADDTGS
FCIRDVRSGTYALYAWGNGRPIADVITNFTHNDVEIVKGKTTTLPLLTWPVTNRTKRIFQ
IGDFDRKTDGFYLADPAIPVQHARIDKCPANLTYTVGTSTPSRDWCFGQSKLGTWSVSFP
VPSANSTAARLVVSLAGFSQGSSADILLNEAKIGNITSASLANSQDTYRGATRAGEWRRL
EFGVPRGLFKEGQNRLDVRVTKSTQWRGWLWDSLVLEAV
Download sequence
Identical sequences M2TIQ2 N4WXS7
jgi|CocheC5_1|110283|estExt_Genewise1Plus.C_160557 XP_014078139.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]