SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014093139.1.97495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014093139.1.97495
Domain Number 1 Region: 404-622
Classification Level Classification E-value
Superfamily Bet v1-like 3.85e-29
Family STAR domain 0.0082
Further Details:      
 
Domain Number 2 Region: 56-170
Classification Level Classification E-value
Superfamily PH domain-like 8.13e-25
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014093139.1.97495
Sequence length 633
Comment PREDICTED: collagen type IV alpha-3-binding protein [Bactrocera oleae]; AA=GCF_001188975.1; RF=representative genome; TAX=104688; STAX=104688; NAME=Bactrocera oleae; AL=Scaffold; RT=Major
Sequence
MDENLITESETISRVNPYSTIISANTLASTIGTLSSTPPKSLDSRTIRNSFPVDTSSLSD
DSDNEYLDNSIELRGYLSKWTNYIYGWQPRYIVLKNGTLSYYKSESESDLGCRGAISLSK
ATIKAHDTDEQRFDVVVNNYNNWCLRAETPEDRMHWVEVLQMYKEETGSTDTTSLRRHGS
AISLQSNTVSVASGSSLKKSQRNLMEKVGEIETFKDILFGQIETLQRYFDACVDVNKLTG
KPLDLGDGLKPIDFKGESITFRATASGVLTTLQHCLEIIAESDDLWKRKLEREIERRKRS
EEQNRKYKDEIEKVKRISYPGPDLEEGPHSTLPEDEFFDAVETGLEKIEEDMQIRAKLKL
QTQQSLTLANVPYQAQQKGDDPSTEEFGTGGLARSHILWPEIDRVCREQLHYAREGVGQG
GNGWQIFADEGEIKMYKREEEVNGLVMDPLKAYHSVNGVTAREMCHYFFMPEFRNEWETT
LEDCTILEKISPDTFVFLQTHKRIWPASQRDALFWSHMRKITDGLDDDAVDMWVVCNNST
EYSKQESKNGKCVRIFLTVILACQTILPAGKTNNDILCRDELTCKITYCSVVNPGGWAPA
SALRAVYKREYPKFLKRFTGYVIDQCKDKPVMF
Download sequence
Identical sequences XP_014093139.1.97495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]