SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014094822.1.97495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014094822.1.97495
Domain Number 1 Region: 132-579
Classification Level Classification E-value
Superfamily Sema domain 5.49e-128
Family Sema domain 0.0000576
Further Details:      
 
Domain Number 2 Region: 1450-1578,1770-1931
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-42
Family p120GAP domain-like 0.052
Further Details:      
 
Domain Number 3 Region: 940-1037
Classification Level Classification E-value
Superfamily E set domains 0.000000000000448
Family Other IPT/TIG domains 0.0081
Further Details:      
 
Domain Number 4 Region: 582-633
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000288
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 1034-1122
Classification Level Classification E-value
Superfamily E set domains 0.0000000000966
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 6 Region: 1141-1223
Classification Level Classification E-value
Superfamily E set domains 0.000000311
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014094822.1.97495
Sequence length 1988
Comment PREDICTED: plexin-A2 isoform X2 [Bactrocera oleae]; AA=GCF_001188975.1; RF=representative genome; TAX=104688; STAX=104688; NAME=Bactrocera oleae; AL=Scaffold; RT=Major
Sequence
MPVIIWFLLAFMLPYVTSIGSINTQNSQIKSNSRINENNHISTDILYASSLLNAVRIHKT
ELLSDEEDLVQNSDGIIDGFTSASLKSALSDNNGGSSPSSSESAQFGGKDDSEKGGAVDA
KNYSNIITNVINFDTRLNHLVVDPFTGRVFVGGVNYLYQLSPELELHETVKTGPKNDSVE
CTVLDCPAHAVRKPTDNYNKVLLIDRSTSRLIACGSLFQGTCTVRNLQNVSIVEQDVPDA
VVANDANSSTVAFIAPGPPQPSITNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIA
SSAVTTGTRTFINSYAREGYLINYVYGFSSERFSYFLTTQLKHNYHSSPKEYITKIVRIC
QEDSNYYSYTEIPIDCITGGTKYNLVQAGYLGKPSMDLAGSLGITVQDDVLFGVFSVGDG
NVSTDNSALCIYSLKSIRRKFMQNIKSCFNGVGSRGLDFISPNMLCVPTKLQTIGEDFCG
LDVNSPLGGEQPIAVIPVAKFNTRLTAVAATSTSGYTVVFIGTANGHLKKVVVESVDSAN
EYADIPIKVGSPINPDMHYDSRNLFIYVMSHNEVAKVKVYDCSDYGTCGECLGARDPYCG
WCSLENKCSPRSSCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLPQ
LKENLVCAFTTEEKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTKDGPD
LVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPSY
RSGPGFCPTINATGEGSEMLVAAGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLNA
QLLGDTIYCDNMEFQYTSRSPNLTATFAVIWGGSKPLDNPHDIHVVIYRCRDMADSCGMC
LALSEKYNCGWCSSTNTCEVEEQCNKNNEGKTDWLNRMETCPNPEIHLFYPKTGPWEGGT
NITIRGINLGKNFSDIYSGVRIAGISCMPFQEYYVDTKEIVCNVDSPGVQLYRSGRIVVQ
IGDYRGESKQDYEFVDPKITNFTPQYGPVSGGTHLRIVGKYLNAGSRIQAFINEHLRCEI
ISVDVTEAICRTAPSPGIIEGRLKMLFDNGPREFNEYNFKYVLDPSIDQVSSGPSSQLKV
PRGIPAGGIEIAVTGTQFNYIQSPRMYVYYRSEIFYSQCKVQSATEMLCYSPVIETGNDL
FDADNPELLEYGFIMDNVLRVQNLSSKQNNHFELYPNPLYYNFEEDIKYYKSEYLTINGR
NLDRACKETDVIVRIGRGICNITSLSRQQLTCRPPPEVATETGNESGPEVIVRIGHSLQY
RIGILSYASPNLMHDLSKNVQLGIGAGTVVILLIFVAFLVAYKKKTSESNRVLRNMQEQM
DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRTYAMKILFPNHEDHIVLQWE
RPELLRKEKGLRLFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC
TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML
FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQLIDFRPMTVYASIIQQPIFCNSIDMMPT
HTENVPVKVLDCDTIGQVKEKCLDTIYRNIPWSQRPRRDDLDLEWRTGASGRVILYDEDT
TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSNYNFSILSDRNEKCHNRAGSPLNHDLH
ENGIKFWHLVKHHDSDIQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHR
GSALPLAIKYMFDFLDDQAILHGITDHEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSN
IVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYRKWVERYYRDIREMPSIS
DQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTLEEDEFSQKQRLAFKLEQ
VHNMMSGE
Download sequence
Identical sequences XP_014094822.1.97495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]