SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014124724.1.73095 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014124724.1.73095
Domain Number 1 Region: 44-560
Classification Level Classification E-value
Superfamily Sema domain 2.35e-98
Family Sema domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1432-1557,1723-1880
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.57e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 995-1085
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000125
Family Other IPT/TIG domains 0.07
Further Details:      
 
Domain Number 4 Region: 905-985
Classification Level Classification E-value
Superfamily E set domains 0.000000000000369
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 563-615
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000288
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1084-1167
Classification Level Classification E-value
Superfamily E set domains 0.00000000125
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014124724.1.73095
Sequence length 1947
Comment PREDICTED: plexin-D1 [Zonotrichia albicollis]; AA=GCF_000385455.1; RF=representative genome; TAX=44394; STAX=44394; NAME=Zonotrichia albicollis; AL=Scaffold; RT=Major
Sequence
MAPAPLPVPAPAAGAEPRPPALLPLLLPLLPLLLPGRAAGLEVQRKFLSPTLTNNFALDG
PGSRVYLAAVNRLFQLSGGELTLEAEAAVGPVLDSPLCHAPQLPQASCEHPRVLTNNYNK
ILQPDPEQGVLVVCGSIYQGLCQLRSMANISAVAVRFPPGGSDSVAVFPSMLNVAANHPN
ASTVGLVLRRGGGGGGARLLVAATYTGFGSPFFPRNNSLEDHRFENTPEIAIRALNARGD
LAKLFTFDINPSDDNILKIKAGDKARHKLSFVRAFLQHGATPPARRPYAYLALNSEANAG
DKESPAHSLLARICLGEPAEATLNGSGETKKLTESYIQLGLRCGGAADAFTRLVSVFPAR
AAWRSPAAPHGPAPAPPPPEELLFGVFERAGAGGGRGRPQSALCVFRFAEIEETIRAARN
SCLVSPAAGMVTVLDSVVQGTGPACEKRNIQLQPEQLDCGAAHLQHPLAILNPVTATPIF
TYSGLTAVAVASVHNYTVVFLGTASGGLLKINLDSTMKVISRRSISVAYGEPVHPIMQFD
PSDSTYLYLMTSYQMTRVKVAACSQYSTCTECLAAADAYCGWCTMETRCSLQHECTDFTG
ANFWVSVSEGVQQCPSMTILEPEISIDKENPALIIQINGTIPNLNGTDISCDYGNNIRTV
ARVAGDYVNQFIYCSLLPREKYPAFPDDQDHVVVETSLRVNSKNIIRANFTIYDCKRIGN
IYPTRACTSCLSARWKCHWCPSAYSCVSNRSQCEDALRMEQKKIDCPQIVPAPMEPMPTG
VSQNIMISLANATFAKETALECHFGADGTFEARWVNSSAVECVHVLLHTSEKSHRFPVNL
QLKDKPDRFIDSPEMMTVEVYNCATGSADCSQCLGREDLGHRCLWSESSSSCRLQTEPPQ
VAEACPPPEIRKIEPLRGPLEGGTLLTIRGRNLGRRFSDIAGAVRVGAVRCAPLPHRYVV
SETVVCQTGEAAEAFSDVVTVNVSREGRSRERYSYVLPVVQSIAPLNGPKAGGTRVTIRG
SRLDVGSELRVLINSSKQCTDLSRTDSSITCTMPAAELTAAVPVCVQFENKSCASHNITF
KYEKNPVISDINPKKSQISGGRIITLEGRGFGLVQNVSMAVRGIGREHTRCKVHTDTAIT
CPSPAASNVTAGTKPAPVDFYLNGRLYADERSALDEEMYPEEALHVSKFSLGYYADPQFS
TAKKEKWIKHHPGEPLTLVIHKEPDSLGLESNEYQVKIGLISCEIQIVSDKVIHCSINES
LSSSERQLPVTIQVGKFNYTIAMLHLGGGETAIIVSIVICSILLVLSVVALFVFCTKSRR
AERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTF
FPKCSSLYEECYILPSQQPSSQVGSQVQETHPLLVGEWKVPENCRPNMEEGISLFSTLLN
NKHFLIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKN
PKLMLRRTESVVEKMLTNWMSICMYSYLRETVGEPFFLLICAIKQQINKGSIDAITGKAR
YTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLSQVKEKILEAFCKNVPYS
QWPRVEDVDLEWFATSTDSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKK
DTTLSRVKDLDTEKYFHLVLPTDESVEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFL
DDLFKAILSIRDDKPPVAVKYFFDFLEEQAEKRGITDPDTLHIWKTNSLPLRFWVNILKN
PQFVFDIDKTDHIDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQRY
YKQIHDMPPLSEQEMNAHLAEESRKYRNEFNTNVAMAEIYKYAKRYRSQIVAALDANPTT
KRTQLQHKFEQVIALMEDNIYESCSEA
Download sequence
Identical sequences XP_014124724.1.73095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]