SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014137217.1.10750 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014137217.1.10750
Domain Number 1 Region: 160-229
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000445
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 107-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 220-278
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000737
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 4 Region: 55-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 5 Region: 390-509
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000262
Family Fibronectin type III 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014137217.1.10750
Sequence length 674
Comment PREDICTED: sushi domain-containing protein 1 isoform X5 [Falco cherrug]; AA=GCF_000337975.1; RF=representative genome; TAX=345164; STAX=345164; NAME=Falco cherrug; AL=Scaffold; RT=Major
Sequence
MLRVEEQFYHSAVVNRSIPDVCATCHIHATCHQIEGKSVCICNYGFVGNGRTHCQDKDEC
QIGASKICGNHTLCHNTHGSFYCVCLDGYRASNNNKTFIPNDGTNCTDIDECEESGLCGP
NASCMNTEGSYKCYCNDGYKLENGEHSFHPDENIVSCKGVDCGVPPSVLNAHPVFVTGTT
YGSEVIYSCVDGYFVASGNQTAVCNARGQWDGTDLVCKEIDCGKPLLIPHTEMTWDNSTT
LWSRVYYQCKDGYYSNGDRNFSECTTDQSWENITYICKEEELLSNLSIFNETCVKWRRKT
GRLGLQETYTFHLLGQRWDEKTFSEDVIFNITTSEDNPKVCLDLNPGSNYVVNITAISSR
NTIVSVTVAVQTKVKEAFNNVLIFNDTCLKWQRTVRGTDVEDRYSFHVQGQRWYQKEFFH
EMTFDLTTHKQAPEVCFDLQPGTNYSVNISMVALNFSLLVSMTTQITDPPFPDIEFVAVK
GSAPLLRLRKAEDQNGPISLYQVIVLPLGLQSTFICDSFAAAAFFSNTTDVKGYVAAEFQ
AKDVADNMSIALGDRHYYGKFYNAPLKLGEEYCVFLRIISEWNKVRTQSCAVWAQIKNLS
PTLQYMSAVGLGSVAAVCLILFLSFSVARAYLHSTVRFPPAAFACEAVHLSATMDVAQTG
ITSSFLETENVSRL
Download sequence
Identical sequences XP_013155563.1.75256 XP_014137217.1.10750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]