SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014146351.1.97753 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_014146351.1.97753
Domain Number - Region: 15-147
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0188
Family Ricin B-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014146351.1.97753
Sequence length 151
Comment hypothetical protein SARC_14997, partial [Sphaeroforma arctica JP610]; AA=GCF_001186125.1; RF=representative genome; TAX=667725; STAX=72019; NAME=Sphaeroforma arctica JP610; strain=JP610; AL=Scaffold; RT=Major
Sequence
IDTSIDVTNGGGNTVTNNGGGNTVNNNNGGDQDTPTMVVKECRITHPDDTLNQYLDIVNN
KAVMVTKKPDRWMIEYVSETEFTMRRGAKYLVAEDTTVPGTNGDNIRLTVNTSKTAPNNK
WIMNSADVVMLMVAGKFIEYEDQKWHFVDCI
Download sequence
Identical sequences A0A0L0F730
SARC_14997T0 XP_014146351.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]