SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014159087.1.97753 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014159087.1.97753
Domain Number 1 Region: 795-846
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 44-145
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000978
Family Ricin B-like 0.035
Further Details:      
 
Domain Number 3 Region: 264-334
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000144
Family Cysteine rich domain 0.075
Further Details:      
 
Weak hits

Sequence:  XP_014159087.1.97753
Domain Number - Region: 506-611
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000147
Family Cysteine rich domain 0.049
Further Details:      
 
Domain Number - Region: 191-239
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00471
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number - Region: 447-497
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00641
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014159087.1.97753
Sequence length 903
Comment hypothetical protein SARC_02605 [Sphaeroforma arctica JP610]; AA=GCF_001186125.1; RF=representative genome; TAX=667725; STAX=72019; NAME=Sphaeroforma arctica JP610; strain=JP610; AL=Scaffold; RT=Major
Sequence
MRGFAFTVSLILAASISFVAAQDNEQQIIPAFQSVSLDNDPYENYVMRQNRTANCIGVGD
IDTSDPYPIIEPCTADLSQVWLRIADFENQGQWQNRVTQTCITVPYNGDQVILKTCSATT
LNNQKILDDALIAPRPNTATNVCLGPCADASGRLCTFEAGTVDWCAVPDTNEPAFNYELY
AEEFCQSPISEGRWEIDFYGECSTTCDTGLRPVTYVCSSLRDLEYSCCGDLPENEVPCNS
VPCGASVSNYKVIKSTASLDSPDATPLCIDAIDPTHVEMRPCAGSDSQLFIQINPKDDKQ
WVNKATGNCIQVPERYNMDKQTDFIFLRPCQDDYSDSDNFRYQQFAVDELVETRVRTCLT
PCDSLADGTLFEPSLDDLLIAGRQEEEAFFNPAADNKDAVCAVRDNDNNVTPWCQAGSFS
YLGLDLYNRRMEDQLWCQQEESAGSWQYFGEDQCSAQCDGGIQRFDYRCIPEDPNVETAC
CGTKPGESSRLCNAQPCDATLDDTWVLEDLRDRGRCATTQDDNTLTFSDCLSGAETQRFL
WLEQPRSGSSETQQWFQPSTQLCVTVLWDREGGLDQEAEVRMSNCSITPDDMQFFHKPSY
LINTAIAACLAPCTEDEDKVCAFGQEGSDWCTADVSTPKNTYMKGFKYCLQDGIDCPVDS
GLVTVTQFTTVEGPEPTFASTTTSTILVTSTEGGSSAAVSTSTSVQLTTVTQDVTVSEVT
TSTQEVTITTEDVTTTTEALVPVTSTSEVVFPVFSTSDVVTTSLGATTFNPFGDATTGVT
TGDTIAGDDTDATTGDGVDGNWSEWAECTVTCSFGIQTRECNNPAASGGGAECPGAAIRT
CNPGPCARALDMRSVDEGEVRFAESEEYKVKFNSGEGNVGNMNTKASQRRSAKLGTGQDT
GRS
Download sequence
Identical sequences A0A0L0G857
SARC_02605T0 XP_014159087.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]