SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014166740.1.5688 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014166740.1.5688
Domain Number 1 Region: 430-648
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000136
Family GUN4-associated domain 0.071
Further Details:      
 
Domain Number 2 Region: 4-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000034
Family APC10-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014166740.1.5688
Sequence length 910
Comment PREDICTED: centrosomal protein of 104 kDa [Geospiza fortis]; AA=GCF_000277835.1; RF=representative genome; TAX=48883; STAX=48883; NAME=Geospiza fortis; AL=Scaffold; RT=Major
Sequence
MPHKIGFTVVSSSGHEDGFSARELMVHAPTVNGWRSPRLCQYPQEITLQLVERCRIRKLQ
LLAHQYMIASKIEFYISESLPEYFAPYQSERFQRLGYVPLSDNEKTDFRARELKSVYMDA
VGQYLKLIFHKNYVNKYNLYGQVALVAVNIIGDPADYGIDSMSSPSREKLIDRLLGIKSD
DPALDGTYLGKHDSISPLDDLAFDMYQDPEVAQIIRRLDEKKREAVHLECYDHAKKLKQA
IADLQKVGERLGRYEVEKRYAVEKEDYDLAKKKKEQMDEYRLKVYQQLELHDLLDAQLLI
RKTELPLGSVSGTESPQSSPPEPADPPQAEPLRAEPVLEEQLVDPTSSEPVVPYQSPLSP
QTQPTTSKENVEILPYDERPLPTICKQVDEAVAYAEPEVTEEDVGDAPRTGNAGEPEQLT
QKALREASPVVEVFGETLVSGAYSRTWSCREEALQAVYKKLMEVSVDTPKEDLRNMLRAA
VFLVRRAIKDTVSSVFQASLKLLKMIITQYIPKHKLGKLETSHCVETTLPHLLSRTGDSS
SRLRLLASTFIQEIALCPEVKPLQIIPVHLVKTLKPNSPTHLAMSHVELVESLLGAMGTE
NSGFTVNNVMKFATGALEHRAHEVREVVLRIIFAMYREHRAAVLEYFPLDNAGARRTVRY
KTLFEGFAKIDGKSSESEVRAQRKTATEAEKQTKEEMKVLKGHPAALKLVLQAELEDEEE
KESYFQKRDNQGYQVYEATAGNIQEELSSVANYLDNLCIFCGERNESFTEEGLDLHYWKH
CPMLTRCEHCKQMLEICSLTEHLLTDCDKRDSFGRCPRCREAVPRDELPRHIKSRICNPA
KPENVANHCPLCHENFPPGEEAWRSHLMGRDGCKMNQRRTSLLNKTILVHPGKTSVNDNN
ICTFYCVAFA
Download sequence
Identical sequences XP_014166740.1.5688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]