SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014192034.1.24487 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014192034.1.24487
Domain Number 1 Region: 218-395
Classification Level Classification E-value
Superfamily MIR domain 1.24e-46
Family MIR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1077-1168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-18
Family SPRY domain 0.086
Further Details:      
 
Domain Number 3 Region: 658-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000499
Family SPRY domain 0.06
Further Details:      
 
Domain Number 4 Region: 3897-3975
Classification Level Classification E-value
Superfamily EF-hand 0.00000011
Family Calmodulin-like 0.056
Further Details:      
 
Domain Number 5 Region: 435-547
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000275
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 6 Region: 102-183
Classification Level Classification E-value
Superfamily MIR domain 0.0000288
Family MIR domain 0.021
Further Details:      
 
Domain Number 7 Region: 2062-2130
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000366
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014192034.1.24487
Sequence length 4842
Comment PREDICTED: ryanodine receptor 3 isoform X13 [Haplochromis burtoni]; AA=GCF_000239415.1; RF=representative genome; TAX=8153; STAX=8153; NAME=Haplochromis burtoni; AL=Scaffold; RT=Major
Sequence
MAEGGEGEDEIQFLRTDDEVVLQSVATIQKEHRKFCLAVEGLGNRLCYLESTSEAKYVPP
DLCVCNFVLEQSLSVRALQEMLANTGQSSEGAGQGGGHRTLLYGHAILLRHSFSGMYLTC
LKTSRSLTDKLSFDVGLQEDSIGESCWWTIHPASKQRSEGEKVRIGDDLILVSVSTERYL
HLSISNGNFHVDASFMQTLWNVQPTCSSSNMAVGFLIGGHVMRLCHGHDESLTIPGADKS
EEEQRIVNYEAGKGASRARSLWRVEPLRISWSGSHIRWGQPFRLRHLSTGHYLALTEDRG
LVLQDRVKSDTTATAFCFRASKEKGDTGPKRDIDGMGVPEIKYGDSVCFIMHVATGLWLS
YQAPDAKSSRLGPLKRRACLHSEGHMDDGLILQRCQHEESRAARIIRNTTFLFTNFIKAL
DSIAAGESTAVAGYVEEVLQTLNDLIEYFKQPDSELEHEEKQCLLRSLIKRQDLFKEEGM
LSLLSKCIDRMNLYDSAAHFGEVAGEEAGAAWKDILNLLYELLAALIRGNRNNCTQFSRK
LDWLVSKLERLESSSGILEVLHCILVESPEALNIIQKGHIKSIVSLLYKHGRNHKILDVL
CSLCVCNGVAVRANQNLICDNLLPNRDLLLQTRLVNDVQSMRPNIFLGIAEGSAQYKKWY
YELVIDQVDHFVTNEPTHLRVGWANTKGYAPYPGGGEGWGGNGVGDDLYSYSFDGLHLWS
GRIPRAVASINQHLLNSDDVVSCCLDLGAPSMSFRINGQPVQGMFEDFNTDGFFFPVVSF
SAGVKVRFLLGGRHGDFKFLPPAGYSPCYEALLPKEKMHVEPVKEYKRDHDGVRDLLGTT
QFLSQASFIPTPVDTSQIVLPPHLENIRDKLAENIHELWGMNKIELGWTYGKVRDDNKRQ
HPCLVDFAKLPETERNYNLQMSSETLKTLLALGCHVAQVNIHAEEDLKKIKLPKNYMMSN
GYKPAPLELSDVRLNAGQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSRRNPRLVP
YALLDERTKKSNRDSLREAIRTMVGYGYEIDPPDQEVVHMLDDQSIETIRFFRVEQTYAV
KTGKWYFEFEALSGGDMRVGWARPGCRPDVELGVDDQAFVFDGYRGRRMHAGSRYFGQPW
KKGDVVGCMINMEDKSMIFTLNGELLITSKGSELCFTDFETEDGFIPVCSLRMSQIGRMN
LGKDASTFKYYTMCGLQEGFEPFAVNMNREVTMWFSKRLPTFFNVPEYHPDIEVTRIDGT
VDSPPCLKVTHKTYGTQNSNNDMVYCRLSMPVEFYSADKLLDESLKLSHPPKEDGSIDFG
SITTYYYSVRVFAGQDPASVWVGWVTPDYHYYSKNFSLSKTRTVTVTLGDERGRVHESVQ
RSNCYMVCVADAVTPSSSSRSSSDLEIGCLADLATGLVSFNANGKELPTSYQVEPNTKLF
PAVFVLPTSANLFQFEFVKIKDAMPLSSAIFKSEHRNPVPQCPPRLDVQTIVAVLWSRMP
NTFLNVETARVSERHGWVVQCLEPMQMMAVHIPEENRCLDIMELSEHEDLRKFHYHTLKL
YCALCALGNTRVAHALCSHLDQSQLLYTIDNQYLSGMLREGFYNVLISIHLETAKEARLM
MNNEFIIPVTDETRSIKLFPDESKRHSLPGVDLSTSLKPRVNFSPVGIINTKRQQFLYSP
QIPLGILKEKAISMLTEAVQGGGTHIRDPVGGSLEYQFVPILKLIGTLLIMGVLTSDEVR
LILLLIDPNVFGETKEGEEVKGDEVAVSGEKEEVSKNEEKAVEAGEEETKESKPQVKGLL
EKSLPESVKRQMCELLHYFCDCELKHRIESIVSFSDSFVSKLQYNQKFRYNELMLALNMS
AAVTAKKTKEFRSPPQEQINILLNFSAGEDCPCPVEIQDELNSFHEELRLHCGIPVEEEE
EEQDTSIKGRLLALLYKIKGPPQKTEQEPTETEQAAPTNLKELISQTITSWAQESHIQDS
ELVRVMFSLLRRQYDGIGELLRAMKKSYTISAASVQDAINLLASLGQIRSLLSVRMGKEE
EKLMIDGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGGDKSQEIAFPKMVASCCR
FLCYFCRISRQNQKAMFDHLSYLLENSSVGLASEAMRGSTPLDVAASSVMDNNGLALALE
EPDLEKVVTYLAGCGLQSCAMLVAKGYPDLGWNPIEGERYLSFLRFAVFCNGESVEENAN
VVVKLLIRRPECFGPALRGEGGQGLLAAMEEAIKISEDPALDLPKTPAGVTTGSGEEEGE
VIHMGNAIMSFYSALIDLLGRCAPEMHLINAGKGEALRIRAILRSLVPTSDLVGVISIPL
KMPVVNKDGTVTEPDMSACFCPDHKAPMVLFLDRVYGIEDQSFLLQMLEVGFLPDLRASA
SLDTEVLSTTETALAMNRYIGSALLPLLTRCAALFGSTEHHAQLVDSTLQTIYRLSKGRS
LTKAQRDAIEECLLAICKHLRPSMMQQLLRRLVFDVPMLNEYCKISLRLLTNHYEQNWKY
YCLPSGMGSFGTASEEELLLTKKLFWGIFDSLSHKKYDTELFKMAKSCLCAIAGALPPDF
VDSSLGATLEKQASMDAQGNFDPKPISTANISLPEKLEYIANKYAEHSHDKWSSEKMSVG
WKHGDTVDEQAKTHPLLKPYKSLSEKERETYRWPVRESLKSMLAMGWNIERTKEGEAMFQ
QRESEKQRKISESQINGFSPAPMDLHNVTLSRELQGMVEVVAENYHNIWAKKKKTELVSK
GGGTHPLLVPYDTLTAKEKYRDREKAQELFKFLQISGYAITRGLKDMEQDSSSMEKRFSY
KFLKRLLKNVDSAQEFIAHLEAMATSGKTDKSPHDQEIKFFAKVLLPLTDQTFKNHCLYF
LSTPSKNLSSCGCASNKEKEMVTSLFCKLAALVRHRISLFGSDSAMMVSCLHILTHSLDT
RTVMKTGSELVKVGLKTFFENAAEDLEKLLEMLKLGKFMQSRAQMKSVSQSINYVTVALL
PILTALFEHIKTYEFGVDLLLDDVQLSCYRILTCLYCLGTGKNLFVERHLPALGESLAIL
VGAMPVAFLEPHLNAHNPLSVFNTKTPRERAILSMPDTVEEMCPEMPRLDKLLKDVNDVS
ESGARYSDMPQVIEVILPMLCNYLSYWWEKGPENSPPDTQCCTMVTSEHLSIILGNILKI
LNSNLGIDDAPWMKRIAVYSQPIICKAGADLLRTHFLPTLDKLKKKTVKVVAEEELLKAD
SKGDNQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSRWLKEPDGDSTELFRMVAEIF
ILWCKSHNFKREEQNFVVQNEINNLGFLTGEGKTKMSKTGGDQERKHKLRRGEYYSIQTS
LIVAALKKMLPIGLNMCTPGDQELVSLAKIRYSLKDTDDEVKEHLRQNLHLQDKSDDPAV
QWQMNLYKDVVVKSEEPANPEHTVDRVQSISAAVFHLEQVEQPLRNKKCVWQKLLSKQRK
RAVVACFRMAPLYNLPRHRAINFFIPAYERLWIEAEEYSFEEKLVQDLAKTPMKIVEEEE
EEVAEIQPDPLHQLILHFSHNALTERSHLEEDPLYIAYADMMAKSCAEDEEEEEEEGKEK
TFEEKEMEKQKILYQQARLHARGAAEMVLQMISSSKGRLGPMVTCTLKLGISILNGGNVQ
VQQKMLDYLKEKRDAGFFKSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSSSKVLQN
DEFTKDLFRFLQLLCEGHNGDFQNFLRTQTGNTTTVNIIISTVDYLLRLQESISDFYWYY
SGKEVIDETGKRNFSKALSVAKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFA
NMQMKLSQDASQIELLKELMDLQKDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSSNVEM
ILKFFDMFLKLKDLTTSDNFKEYDPECKGIISKKEFQKSMESQKQYSQSEIEFLLSCVEA
DENDMFNYKEFVERFHEPAKDIGFNVAVLLTNLSEHMPHDSRLATFLDLAESVLSYFEPY
LGRIEIMGSAKRIERVYFEISESSREQWEKPQVKESKRQFIFDVVNEGGESEKMEMFVNF
CEDTIFEMQLASQISEPEVVEQPEEDEEEDGHSILEELTAEEEHALESASAFTTACRSVK
SKIAHVRQMFSIKNMRKKLKKLKKLSIKEIITGFFAFFWMLFTGFFKGIYSLIFGFFHVI
WSSMFGGGLVEGAKNIKVTDILGNMPDPTQFGIHGDVIEGEKVEAIESLGNLDIAMAPTG
DVVEVDMMMEMLNAPKKEGGKHVEPGLGDVCELSAEPSADHKKKAAAKKVETPENEPEKA
DTENQEKEDKPKEEEAKEPVTEEKPKTRSSQPKEPAPAFMSSIFAVLDVYLNKTLNYLAR
NFYNLRFLALFVCFAINFILLFYKVTGESDEETDDENRWGADEEDDENTFFDMDEFVLQE
STGYMLPTLRFLAIFHTVISLVCLVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQPSD
DDIKGQWDRLVINTPSFPNNYWDKFIKRKVINKYGDLYGAERIAELLGLDKSALDFDPTV
ETVEKEASLVSWLSSIDTKYHIWKLGVVLTDNSFLYLIWYTTMSIFGHFNNFFFAAHLLD
IAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMK
CDDMMTCYMFHMYVGVRAGGGIGDELEDPAGDPYELYRILFDITFFFFVIVILLAIIQGL
IIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDRTPHGFETHTLQEHNLANYLFFLMYL
INKDETEHTGQESYVWKMYQERCWDFFPTGDCFRKQYEDQLG
Download sequence
Identical sequences XP_014192034.1.24487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]