SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014300994.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014300994.1.53796
Domain Number 1 Region: 5-177
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.65e-73
Family Cyclophilin (peptidylprolyl isomerase) 0.000000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014300994.1.53796
Sequence length 752
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase G [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHY
KSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTN
GSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPK
SKAKKEEKKRHKSSSSSSSSDSDSSSDSQSSSDSSDSESASEEKSKKRKKKHRKNSRKHK
KEKKKRKKSKKSASSGSEAENLDAQPQSTVRPEEIPPIPENRFLMRKSPPKADEKERKNR
ERDRERECNLLNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSRDRFRRSETPPHW
RQEMQRAQRMRVSSGERWIKGDKSELNEVKENQRSPVRVKEKKITDLRHVSESPNRKSEK
EKKIKDHKSSSKERDVRRNSEKDDKYNKNKVKKRAKSKSRSKSKEKSKSKERDTKHNRHE
EKRMRSRSKEKDHENTKEKEKSDSKGKDQERSRSKEKSKQLESKSNEHDHNKSKEKDRRA
QSRSRERDTTKGKHSYNSRTRERSRSRDRSRRVRSRSHDRDRSRSKEYHRYREQEYRRRG
RSRSRERRATPGRSRSKDRKRRRRDSRSSEREESQSRNKEKYRNQEGKSSHRKENSEGER
RMHSKNRDHNSSNDNRDKKADRDQSPFAKIKQSSQDNELKFSTLKHKEDEKTRSSVEKEN
QKSKGQENDHAHDKNKKFDHESSPGTDEDKSG
Download sequence
Identical sequences G1PXW7
ENSMLUP00000016299 ENSMLUP00000016299 XP_006083224.1.53796 XP_014300983.1.53796 XP_014300985.1.53796 XP_014300987.1.53796 XP_014300994.1.53796 XP_014300999.1.53796 XP_014401041.1.60319 XP_014401043.1.60319 XP_014401048.1.60319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]