SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014301037.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_014301037.1.53796
Domain Number - Region: 150-235
Classification Level Classification E-value
Superfamily PH domain-like 0.00123
Family TFIIH domain 0.029
Further Details:      
 
Domain Number - Region: 22-81
Classification Level Classification E-value
Superfamily PH domain-like 0.00523
Family GRAM domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014301037.1.53796
Sequence length 341
Comment PREDICTED: LOW QUALITY PROTEIN: Bardet-Biedl syndrome 5 protein [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MSVLDALWEDRDVRFDVSPQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWH
SLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLIPGSPRL
FTSVIAVHRAYETSKMYRDFKLRSALIQNKELRLLPQEHVYDKINGVWNLSSDQGNLGTF
FITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPV
EKLQASVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDDHPDAFV
AYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS
Download sequence
Identical sequences G1P0F6
XP_014301037.1.53796 ENSMLUP00000003236 ENSMLUP00000003236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]