SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014302693.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014302693.1.53796
Domain Number 1 Region: 40-342
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.42e-57
Family Asparaginyl hydroxylase-like 0.068
Further Details:      
 
Domain Number 2 Region: 1054-1286
Classification Level Classification E-value
Superfamily RNI-like 2.75e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.022
Further Details:      
 
Domain Number 3 Region: 624-699
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000046
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014302693.1.53796
Sequence length 1309
Comment PREDICTED: lysine-specific demethylase 2B isoform X3 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MEAEKDSGRRLRPIDRQRYDENEDVSDVEEIVSVRGFSLEEKLRSQLYQGDFVHAMEGKD
FNYEYVQREALRVPLIFREKDGLGIKMPDPDFTVRDVKLLVGSRRLVDVMDVNTQKGTEM
SMSQFVRYYETPEAERDKLYNVISLEFSHTKLEHLVKRPTVVDLVDWVDNMWPQHLKEKQ
MEATNAIAEMKYPKVKKYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGKIFWLIPPTLHNL
ALYEEWVLSGKQSDIFLGDRVERCQRIELKQGYTFFIPSGWIHAVYTPVDSLVFGGNILH
SFNVPMQLRIYEIEDRTRVQPKFRYPFYYEMCWYVLERYVYCVTQRSYLTQEYQRESMLI
DTPRKPSIDGFSSDSWLDMEEESCEQQPQEEEKEEEEEEEGADKVPKPPADGPASPTSIP
SEDQEPPGKKPKAPALRFLKRTLSNESEESVKSTTMPIDDPKTPTGSPTTEVPAKWTHLT
EFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEHADDDPSLAITGVPVV
TWPKKTPKNRAIGRPKGKLGPASAVKLAANRATAGARRRRTRCRKCEACLRTECGECHFC
KDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSI
CNEIIHPGCLKIKESEGVVNDELPNCWECPKCNHAGKTGKAYKQKRGPGFKYASNLPGSL
LKEQKMNRDNKEGQESAKRRSECEEAPRRRSDEHPKKVPPDSILRRKSDDVHLRRKRKYE
KPQEPSGRKRASTLQTSPGSSSHLSPRPPLGSSLSPWWRSSLTYFQQQLKPGKEDKLFRK
KRRSWKNAEDRLALGNKPLRRFKQEPEDDLPEAPPKTRESDHSRSSSPTAGPSTESAEGH
DEKKKVKMRRKRRLPNKELSKELSKELNQEIQKTESSLANENHQPIKSEPESENEEPKRP
VGLCERPHRFSKGLNGTPRELRHQLGPGLRSPPRVISRPPPSVSPPKCMQMERHVIRPPP
ISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHQDLCVCMRVCRTWNRWCCDKRLWTRIDL
NHCRSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIAVSAL
CTSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITD
ASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLTEINLSDCNKVTDQCLS
FFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS
Download sequence
Identical sequences G1PMI9
ENSMLUP00000012120 ENSMLUP00000012120 XP_014302693.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]