SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014309573.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014309573.1.53796
Domain Number 1 Region: 450-614
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000466
Further Details:      
 
Domain Number 2 Region: 628-751
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 743-827
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-16
Family PDZ domain 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014309573.1.53796
Sequence length 834
Comment PREDICTED: amyloid beta A4 precursor protein-binding family A member 1 isoform X1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MNPLEGAAEVEVTDEAAGGEVNESVEADLERPEVEEEQQQQQHHAGRPPRALAVEDPRAQ
PAPPEEEERGECLARSASTESGFHNHTDTAEGDVIAAARDGDDPERTQDPEDESAYAVQY
RPEAEEYTEQAEAEHAEATHRLALPNHLHFHSLEQEEAMTAAYSGYVYTHRLFHRGEDEP
YAEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDEEAAYRQEALGARLHHYDERS
DGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLER
APTPGGGHPDSPGPPAPAGQQRAAGTVVGEAVQRYSKEKRDAISLAIKDIKEAIEEVKTR
TIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPGDGDSPSPGSSSPLGAKSSSTPLHPSD
PAEGSANKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRM
MQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDHPLR
TISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLIAQS
IGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQK
GEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQ
SIIKGLKNQARVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVR
VGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI
Download sequence
Identical sequences G1PA16
ENSMLUP00000007103 XP_006086859.1.53796 XP_014309573.1.53796 ENSMLUP00000007103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]