SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014311604.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_014311604.1.53796
Domain Number - Region: 12-73
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0152
Family BAR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014311604.1.53796
Sequence length 127
Comment PREDICTED: uncharacterized protein C3orf14 homolog isoform X1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MTSLFAQEIRLSKRHEEIVSQRLKLLQQMESKFEDQNKEKASQIQAAEAAFKRNLSLLKD
IEAAEKSLQTWSHPLPPPEVVSLETLYWASVEEYIPKWEQFLLGRAPYPIGVENQNEAEN
TIRNKAQ
Download sequence
Identical sequences G1QDH7
ENSMLUP00000021760 ENSMLUP00000021760 XP_006089105.1.53796 XP_014311602.1.53796 XP_014311603.1.53796 XP_014311604.1.53796 XP_014311605.1.53796 XP_014311606.1.53796 XP_014311607.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]