SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014313214.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014313214.1.53796
Domain Number 1 Region: 144-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000354
Family cAMP-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014313214.1.53796
Sequence length 368
Comment PREDICTED: popeye domain-containing protein 2 isoform X1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MSANSSTLGQRLWQGPVCAGWKQDMEGALYHLANCVLLLGFMGGSGVYGCFYLFGFLGTG
YVCYVLWGWFNACGLDIVIWNFLLAMACLLQLAHLVYRLRKDTLPEEFDLLYKTLCVPLQ
VPMQAYKEIVRCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLPPSEEGVFQVTLTAETPCSYISWPRKSLHLLLAKERYISRLFSVLLGYD
ISEKLYALNEKLFAKFGLCFDIRLPSLYHVLGSAASDAGPESEKEDEEVHEPAPAPPQAM
PTPVQHMPPCSPLPAATHPPAQPSRARMSRPDSDGLGEDSTSLVLEDFEEVSGSESFMDY
RSDGEYMR
Download sequence
Identical sequences G1QCI5
XP_014313214.1.53796 ENSMLUP00000021418 ENSMLUP00000021418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]