SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014317458.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014317458.1.53796
Domain Number 1 Region: 38-153
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-26
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 2 Region: 248-362
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000262
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 451-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 161-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 207-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 412-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014317458.1.53796
Sequence length 765
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MGSAAPGRVNIVLTGRLSSAVPALGEASTSPPLLTAACSGKLEQHTERRGVIYSPAWPLN
YPPGTNCSWYIHIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGSA
IPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPW
QCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGTQDCGDG
SDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDTRRVLLQLELRLG
YDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQ
VKGYCLPWEQPCGSSIEGDMGDTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPC
EGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDG
SDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAE
FVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRR
LGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPAPGAALDPPAPLTDTGSAGAA
GDGSPSAPVHTPEVGPSVLPPLSLQDPEYRPVDKDRKACRDPLMDSPASVDTPREPCSAQ
DPHSLAPTAGSTLGPHPPEPLGVCRSPPPPCSPTEASDDEALLVC
Download sequence
Identical sequences XP_014317458.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]