SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014317460.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014317460.1.53796
Domain Number 1 Region: 27-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-26
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 2 Region: 237-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000249
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 440-477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 150-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 196-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 401-438
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014317460.1.53796
Sequence length 754
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X3 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MGSAAPGRVNIVLTGRLSSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYI
HIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGSAIPPAFISARDH
VWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQCNTVDECGDG
SDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGTQDCGDGSDEAGCPDLAC
GRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDTRRVLLQLELRLGYDDYVQVYEGL
GERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQP
CGSSIEGDMGDTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYTPA
DRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVP
RKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYG
QLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHR
PRAPRGQIPLLTAARTSQTVLGDGLLQPAPGAALDPPAPLTDTGSAGAAGDGSPSAPVHT
PEVGPSVLPPLSLQDPEYRPVDKDRKACRDPLMDSPASVDTPREPCSAQDPHSLAPTAGS
TLGPHPPEPLGVCRSPPPPCSPTEASDDEALLVC
Download sequence
Identical sequences XP_014317460.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]