SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014323704.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014323704.1.53796
Domain Number 1 Region: 226-484
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.14e-53
Family Glycerophosphoryl diester phosphodiesterase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014323704.1.53796
Sequence length 610
Comment PREDICTED: glycerophosphodiester phosphodiesterase domain-containing protein 5 isoform X1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTVTFGLTLTWLY
FWWEVHNDYNEFNWYLYNRLGYWSDWSVPILMTAATAFTYIAGLLVLALCHIAVGQQMNL
HWLHKMGLVVILVSTVVAMSAMAQLWEDEWEVLLISLQGTAPFLHMGALAAVTALSWIVA
GQFARAERSSSQMAILCIFSAVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGVPMLA
PEHTLMSFRKALEHKLYGLQADVTISLDGVPFLMHDTTLRRTTNVEEAFPELAHRPASML
NWTVLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLALAKGNATLLLNLR
DPPRDHPYRASFLNITLEALLRSGFPQHQVMWLPNRQRPFVRKVAPGFQQTSGSKEEATS
LHRGHIQWLNLRYTQVSRQELRDYASWNLSVNLYTVNTPWLFSLLWCMGVPSVTSDNSHT
LSQVPFPLWIMPPDEYCLMWVTADLISFTLIVGIFVLQNYHLIRWRLGGIRSYNPEQIML
NAAVHRTSRDVSIMKEKLIFSEISDGMEVSDELSVCSDNSYDTYANSASTPVDPRGTGSH
TKTLADRSGR
Download sequence
Identical sequences G1P1M9
XP_014323704.1.53796 ENSMLUP00000003730 ENSMLUP00000003730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]