SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014325175.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014325175.1.87360
Domain Number 1 Region: 12-132
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.96e-29
Family Hormone receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 105-429
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000192
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014325175.1.87360
Sequence length 518
Comment PREDICTED: glucagon receptor [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MSRLFLFLAVLIVSCSIQMSPAATLDKLKDDWKRYRTECEYNNSQYPPSSGLVCNRTFDD
YACWPDGFPNTTVSVECPWYLPWYHKVQHGMVYQDCDANGQWVTKYNTTECEIHSTNQIY
YRCIWIMYTVGYSLSLVALVLALGILIFFRKLHCMRNNIHMNLFASFILRALSVLIKDAL
LEANFTSQKISGDRDQGFPSESIPPVELLTTVSCRTAVVMMQYSIMANSYWLLVEGIYLH
NLLVITVFTERNYFKIYLCIGWGTPLIFLVPWAVSKYLYENKECWEQNTDMNIWWIIRAP
ILLGVVINFIIFIHIIKILVSKLRAHQMRYTDYKVRLAKSTLTLIPLLGIHQIVFIFLPE
ETTNKSLHLRLTKLFIDLFFSSFQGLLVAILYCFVNKEVQSEILKKWKRWKLGRNIEEEY
RHTYSNSNNTKTASLLNHIPRLPHLPDIAKSSGPVCRPEEQTWLVACCHNGMVHGKETEN
SSSQQNEGTSNCTLVEDINQSGKMQCYEVQRENVESHL
Download sequence
Identical sequences M4AEX3
ENSXMAP00000013017 XP_014325175.1.87360 ENSXMAP00000013017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]