SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014326329.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014326329.1.87360
Domain Number 1 Region: 154-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000639
Family EGF-type module 0.0015
Further Details:      
 
Domain Number 2 Region: 45-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000288
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 113-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000918
Family EGF-type module 0.027
Further Details:      
 
Domain Number 4 Region: 9-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000817
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014326329.1.87360
Sequence length 203
Comment PREDICTED: notch homolog 2 N-terminal-like protein [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MHSCPGLQCVDEKAPCINNATCLTFNNGTEYCRCAPGYLGEYCQHKDPCQPGYCLNGGNC
SVSMSAGVPVPGSTSCTCPLGYTGQRCQTPQNSTCYPNNPCANKGVCTLLSLVKDDACIS
NPCREGSHCDTNPITGMFNCNCPPGYIGNTCNRDRDECSIGPNPCEHGGQCVNTDGSFTC
NCVKGYSGPRCEQDVNEGAPTPA
Download sequence
Identical sequences XP_014326329.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]