SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014326742.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014326742.1.87360
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 2.22e-96
Family Sema domain 0.001
Further Details:      
 
Domain Number 2 Region: 1380-1505,1671-1855
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-35
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 855-946
Classification Level Classification E-value
Superfamily E set domains 0.00000000000014
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 4 Region: 1038-1117
Classification Level Classification E-value
Superfamily E set domains 0.000000000000344
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 5 Region: 946-1036
Classification Level Classification E-value
Superfamily E set domains 0.00000000000344
Family Other IPT/TIG domains 0.039
Further Details:      
 
Domain Number 6 Region: 516-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000127
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014326742.1.87360
Sequence length 1895
Comment PREDICTED: plexin-D1 [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MPPSMEIAVLLLGVLTLETRRSASALHIQQAFASPNLTNNFVVDPVSRRVYLATVNTVYQ
LNGTLTVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLELDREQGVVVMCGS
VYQGFCELRRMGNISEIAVEFPPRGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDATMGHKENQPNSILARICLDSDIPRKSTGSESK
KLTESYIQMPLQCGANGNIHNRLVSVYSAEVHGGSGGVPEPYLFGAFSKADRKSALCAFK
FGDIEAEIRQGRWNCSNSPSSDVQVLDSVIQGSGAVCIQKGNIVLQPEQLDCGAAHLQHP
LALRRPLRAIPLFEFQDLSSVSVDNVHNHTVVFLGTSNGCLHKLTLFPNMTLASKSTMKL
PAGEAVHHIMTFDPNDGNFLYVMTSHHMLRVKVAECDQWKSCTDCLGARDAYCGWCTLEN
RCTIQNECARGLLPRSWITLGEGPKQCPSITLTPPEISISSEIEAVGILINGSIPDLIGS
KVECEYKPGVSTAATVYGLAQIQTCPLLSPENYQPIPFGTDHLTVSVAIKVNGTSVVSGS
FIIYDCERTGQIHPKTACMSCLSTRWKCYWDQEHHQCLSSKDESKPNLLESAASCPSLIP
SETVPSPSGMAQDFTMTLSNIQGKEKLECDFGTEQHFVAIWLDNSTVKCSGVTLFTNKRS
QIYHLSLRRAGYFISQREDIFLDSPQPMKVEVYNCGVGSSDCSQCWGREDQGHLCGWCEN
SCRPRDDCQPDRDVCPAPEIHKISPLRGPVEGGTLLTVQGRNLGRRPAGVNIFIGDVPCD
LLPERYTVSVELVCHTGRSLHDRTDSVRVDVDQSGTGTSKESFAYLVPNVKSIYPEKGSR
VGGTRVTIRGKHLDIGSQVRVKVNGTQECTITEKTDQTIKCIMPPALEADAELVTVCVEF
EDHPCEEANISTMYTYEQNPTISSIHPTKSFLSGGRTITVKGHGFDLVQSVTMNVLEIGQ
TNCSVLSSSTITCLSPESSQSQETSVQFVLNGVPYTGDSPSSSDDRPGEPHKEHFQLGYV
EDPQFFTTNKDKQIKHHSGEPLTLIINQKVPSELELVPEEYSVMIGSYPCNISFHNDQLF
HCTINGQLRSSESELPVTVQVGNFRHMITKVQLGGSELAIVVSIVVCCVLLLLCTVALVV
YCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYK
QFVTRTFFPKMCSDYENSLVQPTYVNDSLGPRVLPETHPLLQDWQVKANDTTRPNVEEGI
TLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLVDL
IDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGSI
DVLTGKARYTLNEEWLLRENIETKPQNINVSFQGCGMDSLSVRVMNTDTICQVKEKIIEA
FYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIPEGASL
AMSMKDKKENTLERVKDLDTEKYVHLVLPHDELIETKKSHRHSHRKKVLPEIYLTRLLST
KGTLQKFLDDLFRAILSIPPDRPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLR
FWVNILKNPQFVFDIDKTDHMDACLSVIAQVFIDACSISDLQLGKDSPTNKLLYAKEIPE
YKKNVQCYYKQIQEMPPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRNQVVN
ALEANPTARRTQLHHKLEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_014326742.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]