SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014331513.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014331513.1.87360
Domain Number 1 Region: 453-588
Classification Level Classification E-value
Superfamily TIMP-like 1.26e-26
Family Netrin-like domain (NTR/C345C module) 0.023
Further Details:      
 
Domain Number 2 Region: 228-324
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 406-460
Classification Level Classification E-value
Superfamily BPTI-like 3.41e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 
Domain Number 4 Region: 343-401
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000326
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.028
Further Details:      
 
Domain Number 5 Region: 144-196
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000208
Family Ovomucoid domain III-like 0.037
Further Details:      
 
Domain Number 6 Region: 52-99
Classification Level Classification E-value
Superfamily Elafin-like 0.000000144
Family Elafin-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014331513.1.87360
Sequence length 590
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MPEILLQLFQVRHSKDKRWQSKPPFRWTRVFLLVFLICDFLDFSLTASVTGATAEHEGFC
PNKLNTNLWVDAQSTCERECSLDEDCAEHEKCCTNVCGLNSCVSARFSDGTPAQPDGKEG
GADGDAAPASTATCEGFICSQQGATCDIWDGQPICKCQDRCEKEPYFTCASDGLTYFNRC
YMDAEACIRGVTLTVIPCRFYLAGPHTSPLPLDTTVSPTTTSSQEDPMPPTLYSNPHHQS
IYVGGTVSFHCDVIGVPRPDVTWEKQSERRERLVMRPDQMYGNVVITNIGQLVVYNAQVW
DTGIYTCIARNSVGVLQADYPLSVIRRADDDFSEDPELPMGRPFSPADCLAEVDTRVCSG
ERHVDWYYDSKLSSCMTFSSGGCDDSRNRFETYEECKASCQREGMGICSLPAVQGPCKNW
EARWAWNSLLKQCQPFAYGGCQGNANSFATKKECEANCPQPKRKPCRTCRMRGKMMPTLC
RSDFAIIGRLTELIEDLDSGLAHFSLDEVLRDEKMGLTFFNTKNLEVTIVKIDWSCPCPN
ITMDENPLLVMGMVQDGMAIIQPDSYVKAIPERRLRRLRDAINKNTCEAL
Download sequence
Identical sequences XP_014331513.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]