SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014360465.1.63768 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014360465.1.63768
Domain Number 1 Region: 910-1128
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-58
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 79-196
Classification Level Classification E-value
Superfamily BRCT domain 2.36e-20
Family DNA ligase 0.078
Further Details:      
 
Domain Number 3 Region: 215-263
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000538
Family DNA topoisomerase II binding protein 1, TopBP1 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014360465.1.63768
Sequence length 1422
Comment PREDICTED: protein ECT2 isoform X1 [Papilio machaon]; AA=GCF_001298355.1; RF=representative genome; TAX=76193; STAX=76193; NAME=Papilio machaon; AL=Scaffold; RT=Major
Sequence
MDELSKGMSQTGSTVVTDKNQESDGSSSPFIYVSESCLECERVRAACERLGAVEPARAAD
ALPSPQPPPAPPSYLVTTPFDGDLFDAAHRAKYRVLGPTAVLQLAERDEPPPANARPLYS
LAMRGAVICFSGFRKKDELTYLITLIHYMGGSIRKDMSSKVTHLIAAAATGDKYRYATGF
GLPVLARSWVDACWERRDDPACLATDDTVIKEHKLKVFAGARVCFVGFPEDETQHMAEVL
ASNGGATCALDDPDCTHVVMANGETFGRSLILSPPAITPETSAKPSRNTPNRSQNTPKTS
LYRRLSARLSGCRNSPSKHDVDSIENRSRDDREQRLERARNSIKPNQSKDETDNSRISHV
GKSFIDDSCTNSYKNQSTGQAESVELRQYKTCGKENKYSSQALLGSRLSSKDKREVFRNK
SINVFNLVECLTEAGSLHSSLTKSLCDLDCKDESGFLLPTSAISKELQHSTTTISSGKKR
SRNSTESNFQVSVVDANISPDKCDESNWKSIKRLKIKDSFKFKNRPTIFKRTKKESVSKT
VGDITVEPVSPESVKPTDPAGEFVASTSSPIREDDNASVSSLNISKQSGFFDISFASIRS
SKTVKSASKLRRSVKSFTASFRSERKKKYEKRVERNTVEVNPCHLPSDLKNVSTPKRELD
VMNLDISPVQVDTIDSTDMRTPRKDETDVEDCDDSVIFKTPQRVWLRTHRHSICGGADLK
ASVSQSCSAIPAPAPSYSCAPSPAPRPARDQPPPASTPPNRGARAISQCHGLSLPVVDVH
NTGVAPECSPRVHIVKAEWFWASVQNEEAQDEREFLFKDYLEEVSRRSSVGAACGGAGAG
GEEAGAGTPSQAQRMRKRKLRGGEAALHKRRSSFSDAVLLSLSGNLLDCTPSPDGKQLLE
ESEVPDNVVRKLMSPRQQVFMELLQTESNYVGILHTIVTLFKQPLEEMTEDDSSNGKNQP
LLNNTELKIIFGNLPPIYELHQRMLEELRYAQAHWSEEVSIGRLVLRYTPDMVKAYPPFV
NFFENTKEMLQQCDRENPRFHAFLKICQTRPECGRQSLQELLIRPVQRLPSISLLLDDIL
KHTHKNNPDHAALVSALAGLREVMSHINEDKRKTEGQLQMFDIYNDIDQCPAHLVSSHRS
FVSRCEVVELSKELSGRGDHLVLFFFTDTMEVCKKRSKAFNSKSPTNGMGTMRIGSSKPY
RHISLMPLSTVKRVVDIREAEDCHNVFALMCRSNQELKEKLYSFMITDETVDKSHFLRQL
CRQMANTVCKADADKFLACLESHQLDIDTSDLALSTLSRVSKFAARTRIKLEALAGLGGW
LRAEPGAALLDTWVGRALSFNKTPSKLKRAMSSMISPFGSTSNLTPASQLAQMRLASCNN
INEMGTSGGSGAEGGGEVLVAPLSVQPTRKASGARAPALRRF
Download sequence
Identical sequences XP_014360465.1.63768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]