SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014386296.1.60319 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014386296.1.60319
Domain Number 1 Region: 54-630,663-856
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.92e-291
Family Motor proteins 4.34e-16
Further Details:      
 
Domain Number 2 Region: 857-982
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.06e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 977-1093
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.72e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1262-1370
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.49e-18
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number 5 Region: 1370-1471
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000732
Family Myosin rod fragments 0.0088
Further Details:      
 
Domain Number 6 Region: 1535-1648
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000929
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1081-1172
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000251
Family Myosin rod fragments 0.0034
Further Details:      
 
Domain Number 8 Region: 1780-1881
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000436
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014386296.1.60319
Sequence length 1981
Comment PREDICTED: myosin-9 isoform X2 [Myotis brandtii]; AA=GCF_000412655.1; RF=representative genome; TAX=109478; STAX=109478; NAME=Myotis brandtii; AL=Scaffold; RT=Major
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKNGFEPASLKEEVGDEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDSAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDLFQETMEAMRIMSIPEDEQIGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
SYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDEMQSTQRAYFYQRFPILHLEPVDRIIGLDQVAGMSETALPGAFKTR
KGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKSGKLDPHLVLDQLRCNGVLE
GIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQS
KVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAY
LKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLM
AEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKK
KMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEDQIILEDQNCKLAKEKKLLED
RIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTD
LSDQIAELQAQIAELKMQLAKKEEEVQAALARVEEEATQKNMALKKIRELESQISELQED
LESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEE
AKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKALLQG
KGDSEHKRKKVEAQLQELQVKFNDGERVRTELADKVTKLQVELDNVTGLLTQSDSKSSKL
TKDFSTLESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSLKEQLEEEEEAKRNLEKQM
TTLQAQVTDMRKKMDDGVGCLETAEEAKRKLQKDLEGLSQRYEEKVAAYDKLEKTKTRLQ
QELDDLLVDLDHQRQSVSNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKAL
SLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKT
QLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELE
DERKQRSLAVAARKKLELDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDYMRELDDTRA
SREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGAL
ALEEKRRLEARIAQLEEELEEEQGNTELVNDRLKKANLQIDQINTDLNLERSHAQKNENA
RQQMERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRR
AEKKLKDVLLQVDDERRNAEQFKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRE
LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGTGECSDDEVDGKADGAEAKAA
E
Download sequence
Identical sequences XP_014386296.1.60319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]