SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014407324.1.101512 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014407324.1.101512
Domain Number 1 Region: 80-550
Classification Level Classification E-value
Superfamily Sema domain 1.7e-130
Family Sema domain 0.0000184
Further Details:      
 
Domain Number 2 Region: 1265-1385,1580-1719
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-42
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 954-1058
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000127
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.077
Further Details:      
 
Domain Number 4 Region: 868-955
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000586
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number 5 Region: 550-595
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000222
Family Plexin repeat 0.0028
Further Details:      
 
Domain Number 6 Region: 1055-1145
Classification Level Classification E-value
Superfamily E set domains 0.00000042
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014407324.1.101512
Sequence length 1755
Comment PREDICTED: plexin-A1 [Camelus ferus]; AA=GCF_000311805.1; RF=representative genome; TAX=419612; STAX=419612; NAME=Camelus ferus; AL=Scaffold; RT=Major
Sequence
MRAMPFTTLSRLFFRRAEAPRPVMHVPAGPESLGLRPQPTMPLPRLSPPAPPLLLLLLLL
LLLLLGGAPGAGGGPQPAFRTFTANDWALTHLVVHEQTGEVYVGAVNRIYKLSGNLTLLR
AHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDQAANRLLACGSASQGICQFLR
LDDLFKLGEPHHRKEHYLSGVREAGSMAGVLIAGPPGQAQAKLFVGTPIDGKSEYFPTLS
SRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFRSEHFVYYLTLQ
LDTQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYVEFPIGCEQAGVEYRLVQDAYLSRPGR
ALAHQLGLAEDEDVLFTVFAQGQKNRVKPPRESVLCLFTLRAVKEKIKERIQSCYRGEGK
LSLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVTIEGTPLFVDKDDGLTAVAAYDY
RGRTVVFVGTRSGHIRKILVDLANPGGRPALAYESVVAQEGSPILRDLVLSPDHQYLYAM
TEKQVTRVPVESCVQYPSCELCLGSRDPHCGWCVLHSICSRQDACERADEPQRFASDLLQ
CVQLTVQPRNVSVTMSRVPLVLQAWNVPDLSAGVNCSFEDFTESESVLEDGRIHCHSPSA
REVAPITRGQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKY
RHVCTHNAADCAFLEGRVNVSEDCPQILPSTQIYVPVGVVKPITLAARNLPQPQSGQRGY
ECLFHIPGSPARVTALRFNSSSLQCQNSSVRPVEQLGPGTPCAVGQPLTASDLASALADQ
QHVAMSALPGSEGTLGPLGQAAALSCTRTPTFYRVSPARGPLSGGTWIGIEGSHLNAGSD
VAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSASIIININRAQLTNPEVKYNYTEDPTIL
RIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGVERENSCLVYNDTTMVCRAPSVDN
PTRSPPELGERPDELGFVMDDVRALLVLNASSFLYYPDPVLEPLSPTGLLELKPSSPLIL
KGRNLLPPAPGNSRLNYTVLIGSTPCALTVSETQLLCESPNLTGQHKVTVRAGGFEFSPG
VLQVYSDSLLTLPAIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTLKRLQLQMDNLESR
VALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANV
EKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQL
LSDLIDKNLESKNRKTESVAEKMLTNWFTFLLYKFLKECAGEPLFLLYCAIKQQMEKGPI
DAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEVAVKGLNCDTVTQVKEKLLD
AVYKGVPYSQRPKAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSS
VALVPKQTSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLV
KNHDHLDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKY
MFDFLDEQADQHQIHDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVA
QTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKSWVERWACRVGILTALEKDEQARRQRL
RSKLEQVVDTMALSS
Download sequence
Identical sequences XP_014407324.1.101512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]