SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014412020.1.101512 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014412020.1.101512
Domain Number 1 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 236-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 177-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.14e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-20
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-20
Family KRAB domain (Kruppel-associated box) 0.00052
Further Details:      
 
Domain Number 9 Region: 557-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.32e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 10 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000433
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 87-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000448
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 12 Region: 606-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000316
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014412020.1.101512
Sequence length 642
Comment PREDICTED: zinc finger protein 709-like isoform X1 [Camelus ferus]; AA=GCF_000311805.1; RF=representative genome; TAX=419612; STAX=419612; NAME=Camelus ferus; AL=Scaffold; RT=Major
Sequence
MDPVAFEDVAVNFTLEEWALLDPSQKKLYRDVMRETLRNLALVGGKWEDHNTEDKYKNQG
RNLRSHTFERDCESNEGSQDGKNISLSPNLNLNKNSTTAVKPWECSVCGKVFMSRSSLNR
HMKSHTAPKPSMYQEYGKKPYKCKVCGKAFSYLQPFQKHESNHGIEKSYKCKECGKSFRY
RQSVRKHERTHTGEKPYQCKQCGKAFRYHQTFQTHERTHTGEKPYQCKQCGKALSCPSSF
RSHERTHTGEKPYECKKCSKAFSCPSSLRKHERTHTGEKPYDCKECGKAFISLGSFQRHM
ITHTGVGPYKCKDCGKAFNCPSSYRIHERSHTGEKPYECKICGRAFSCSSSFRTHERTHT
GEKPYQCKECGKAFHWLTTFQVHVRTHTGEKPYQCKECGKAFHWLTTFQVHVRTHTGEKP
YICKQCGKALSCPTSFRRHERTHTAEKPYECKQCGKTFSSPLGLQIHERTHTGEKPYKCE
ECGKAFVSLTSFRRHMMTHTGDGPYKCKECGKAFNCPSSFRIHERTHTGEKPYECKICGK
AFSCSGYVQVHERTHTGEKPYECKECGKAFIYRTTFRGHMRVHTGEKPYKCKDCGKAFSR
PSSFRSHERIHTGEKLLECKHCGKAFNWPTSLHKHVTRMHTG
Download sequence
Identical sequences XP_014412020.1.101512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]