SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014454379.1.47583 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014454379.1.47583
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily DEATH domain 1.53e-23
Family Pyrin domain, PYD 0.00054
Further Details:      
 
Domain Number 2 Region: 109-191
Classification Level Classification E-value
Superfamily DEATH domain 4.43e-17
Family Caspase recruitment domain, CARD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014454379.1.47583
Sequence length 192
Comment PREDICTED: apoptosis-associated speck-like protein containing a CARD [Alligator mississippiensis]; AA=GCF_000281125.3; RF=representative genome; TAX=8496; STAX=8496; NAME=Alligator mississippiensis; AL=Scaffold; RT=Major
Sequence
MANVRDALIAALEDLEDAKFREFKFKLKGFPVKSGYNRIPWGQLERADRLDLTDKLISFY
QKDYAQEVTLGVLRGINMNNVASDFAAACGSSNWLPGPPANAPESRAGEHFIERHRKSLI
DRVTAVSPILDELHGDVLQPEQYDTIRSQRTSQEKMRSLYDCVRGWNVACKDKFYAALKK
HEQHLVADLEGN
Download sequence
Identical sequences A0A151NCV7
XP_006275585.1.47583 XP_014454379.1.47583 XP_014454380.1.47583 XP_019346814.1.47583 XP_019346815.1.47583 XP_019346816.1.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]