SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014461002.2.47583 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014461002.2.47583
Domain Number 1 Region: 37-533
Classification Level Classification E-value
Superfamily Sema domain 3.4e-97
Family Sema domain 0.00088
Further Details:      
 
Domain Number 2 Region: 1403-1526,1692-1849
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.37e-35
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 964-1053
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000056
Family Other IPT/TIG domains 0.05
Further Details:      
 
Domain Number 4 Region: 873-954
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000369
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 5 Region: 536-588
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000733
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1053-1134
Classification Level Classification E-value
Superfamily E set domains 0.000000000382
Family E-set domains of sugar-utilizing enzymes 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014461002.2.47583
Sequence length 1916
Comment PREDICTED: plexin-D1 [Alligator mississippiensis]; AA=GCF_000281125.3; RF=representative genome; TAX=8496; STAX=8496; NAME=Alligator mississippiensis; AL=Scaffold; RT=Major
Sequence
MAGRALPRTPPPLLLLLLLRAVVLALALRAGAGLEVQRKFPSPTPTNNFALDGPGRRVYV
AAVNRLYQLAGPNLTLEAEEQVGPVPDNPLCHAPQLPQASCEHARVPTPNYNKILQPDAA
QGIVVVCGSVYQGSCQLRSMANISAVAVRFPPHAANAPSAVPSAEPVTVFPSMLNVAANH
PNASTVGLVLPGGAPGDTRLLVGATYTGFGSPFFPRNRSLEDHRFENTPEIAIRALDARG
DLARLFTFDLNPSDDNILKIKLSAKARHKLGFVRAFLRRARFAYLALNSEANAGDKESQA
HSLLARICLPDAAAAGPGETKKLTESYIQLGLQCGAGAELYNRLVSVFPPPDAADQRLFA
VFERGAGPGPRAPAALCAFRFADVDAAIRAARRSCLAAPDAGLVAVLDSVVQGSGPSCER
RAIQLQPEQLDCGAAHLQHPLAILQPLKATPVFKYHGLTSVAVASVNNYTVVFLGTANGG
LLKINLNEAMKVVSRKSISVAYGEPVHPIMQFDPSDSSYLYLMTSYQMTRVKVAVCNQYV
TCTECLAAADAYCGWCTMETRCSLQHECMNSAESNFWTTASEGVERCPSMTILPSEINID
DTNSGTIIQLNGSIPMLNGTEMFCDYGNNIYTVARAASNDIIYCDLFPREKYPAFPPNQD
HVIIETALRVNGKNIVWTNFTIYDCKRTGNIYPKTACTNCLSTKWKCHWCSRRYTCVSNS
SECEDALHVKSSTDCPQIVPVSLEPMPTGTSQDITISLANAVFSKDTALECHFGTDRTFE
ARWVNSSAIKCSSVLLHTSEKSHIFPVNLQLKHRPDRFIDNPQMMTVEVYNCATGSTDCS
QCLGREDLGHRCTWTESSSSCRLNTESLQTSNTCPAPEIQKIEPLSGPLEGGTLLTIRGR
NLGRRFSDVIHAVKIGGVKCLPLQDRYMVSEEIVCQTGEAPDVFSDVVTVNMSKEGKSKE
RYTYVLPVVHSITPSLGPKAGGTKVTIRGNNLSVGSELRVLVNNTRQCTDISRADTTITC
IMPAVERTTAARVCVQFENKSCTNDNIVFKYEKNPVITDITPKKSQISGGRIITLEGNGF
GMVQNVSMVVHGIGKEKTNCKVHTDTVITCPSPAASNLTTGSKPAPVDFYINERLYADDR
PAPDEDMYPEEAMHISKFSLEYYADPQFFTARKEKWIKHHPGEPLTLVIHKESDNLGLES
GEYQVKIGLISCEIQIVSDRVIHCSVNESLSTSERQLPVTIQVGKFNQTIAMLHLGGGET
AIIVSIVICSVLLLVSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQ
TDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYILPSQQLNSQVGSQVQETH
PLLAGEWKIPENCRPNMEEGIALFSTLLNNRHFLVVFVHALEQQKDFAVRDRCNLASSLT
IALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLRET
VGEPFFLLICAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDS
LSVRAMDTDTLSQVKEKILEAFCKNVPYSQWPRVEDVDLEWFASSTDSYILRDLDDTSVV
EDGRKKLNTLAHYKIPEGASLAMSLSDKKDSMLSRVKDLDTEKYFHLVLPSDESTEHKKS
HRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPVAIKYFFDFLEEQAE
KRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSLS
DLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQEMNAHLAEESRKYRNEFN
TNVAMAEIYKYAKRYRPQIVNALDSNPTTKRTQLQHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_014461002.2.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]