SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014548395.1.23709 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014548395.1.23709
Domain Number 1 Region: 389-500
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.03e-28
Family DEP domain 0.0052
Further Details:      
 
Domain Number 2 Region: 528-680
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.36e-28
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 
Domain Number 3 Region: 215-340
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000114
Family PadR-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014548395.1.23709
Sequence length 700
Comment regulator of G protein signaling pathway, partial [Metarhizium brunneum ARSEF 3297]; AA=GCF_000814965.1; RF=representative genome; TAX=1276141; STAX=500148; NAME=Metarhizium brunneum ARSEF 3297; strain=ARSEF 3297; AL=Scaffold; RT=Major
Sequence
MAALSHRPPIEDDTPSQASKTHHRSHDNHHAHHTPPLKHYTSAPRSSTSDRLTADLTTLP
ASSHHQRHSSTPSASSFSRSQRSATSLLSRAAAALDRTQNAFAGISEPVIRPRHSNSALA
RLSLQSLSAPSPEPSSPGRTAGSKAFSVNGPFAPAPRAQIKVVSPAAQANHPPSQPYSET
DPSLPAPIRVAPSDKKMHQTSSRLLRMTDDDRPFTRDFKDLFATLIVSLLPLSAHRVRLS
KVEYTFLSEDAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKDMARSICQRFVE
ARFIESADGKYQQVYNMKGSVWQLTPKGITVLDRFCSRNGIQQKQVGELSNMSSAQLVIL
ERDQQTDKLLHDWGTIEVIFRRFVGADRRNVKTSVTAADSDSLHDYRDGLTGVKMAAERK
VNGKAYRDTFTGKATTDWLMDCSTIVDRRETVEIASLFVEYDLMEPVVQDRAFMSQNTGY
NLFQPTKHAIYQLTTRGKELISGSGSRGRASESENGTGSQRNGITRDSNTQRLEKILNDA
ALRLLFRENLRETHCEENLSFYKDVGEFVRSCKDAIRQAQKAPNASSMDTIKEIMAQAYG
IYNAFLAPGSPCELNIDHQLRNNLATRMTKAVGQDNTMIETLQEVTALFEDAQNAVFKLM
ASDSVPKFLRNAKYEQQLRNYDLDMSARAPERSQSRSNRK
Download sequence
Identical sequences A0A0B4GHM9
XP_014548395.1.23709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]