SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014578528.1.58995 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014578528.1.58995
Domain Number 1 Region: 310-421,463-485
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000114
Family Regulator of G-protein signaling, RGS 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014578528.1.58995
Sequence length 500
Comment Regulator of G protein signaling superfamily, partial [Metarhizium majus ARSEF 297]; AA=GCF_000814945.1; RF=representative genome; TAX=1276143; STAX=1650735; NAME=Metarhizium majus ARSEF 297; strain=ARSEF 297; AL=Scaffold; RT=Major
Sequence
MGSEFGITPDTKPEVRLDGVGIFWIVFAVTWTVILISGMAFLWTKRDMPILRIRGLGLSF
TAIAFLHCYWVAVTTGYVYGPLMPEVAEFWIMSIWFPFGIALFHASNSRFLYVANAQKQY
VKKTGDLGWDGQRPRIRKTLVARWKMLPYTQRVLIFVGLGMVAHLSLTIFMFLISRKFHS
GWGISGTEVTGTAMEQKTEQGRGWECLHASPMWLIALYVPGMAPVNNYFIPPQWIAIAIM
MLEIFTVFIPVWEVRRQQSLCQETLDSIARWESRQKSVQHSGKSLHSGTSSSSWMGRTKA
GSVSTTGGSILTMDALEHTLAKNPEPLQEFSALRDFSGENIAFLTRVREWRAQYIVNPSL
REPVRDEKDSEKTLTLSRECFESALRIYIDFISSNSAEFQVNLSSQDFKNLQAIFEGAAR
VVCGECSTPDPATPFADVPKPQSESGETARYWGDIPEAFNEGVFDDSEMSIKYLVLTNTW
PKFIRERRSFDGASSAEAGK
Download sequence
Identical sequences A0A0B4IHT3
XP_014578528.1.58995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]