SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014584774.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014584774.1.31192
Domain Number 1 Region: 151-576
Classification Level Classification E-value
Superfamily Sema domain 3.01e-98
Family Sema domain 0.00037
Further Details:      
 
Domain Number 2 Region: 1476-1601,1798-1911
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.98e-31
Family p120GAP domain-like 0.038
Further Details:      
 
Domain Number 3 Region: 1029-1118
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000182
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 4 Region: 937-1032
Classification Level Classification E-value
Superfamily E set domains 0.000000000000133
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 5 Region: 579-631
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000576
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1117-1161,1199-1252
Classification Level Classification E-value
Superfamily E set domains 0.0000000222
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014584774.1.31192
Sequence length 1932
Comment PREDICTED: plexin-B3 isoform X5 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MSVYLPMSLGSCTFPFVCGLPTPLLSPSPACLCGLGPPLSCPPLSPSLSLLLSSLCLSVS
LLSAFLCFSRDLPFLCLSSRFFSPSGALSPPSLFLFCPARWGGRAPARQASGSLAFPQAP
AMAPGPPSGARLLVLLLLLLLCPPHPTQAHRFSAPNTTFNRLALAPGRGTLYVGAVNRLF
QLSPVLQLEAVAVTGPVFDSPDCVPFRDPAECPQARLTDNANQLLLVSSRAQELVACGQV
RQGVCEKRRLGDVAEVLYQAEDPGDGQFVAANALGVATVGLVVPTPGRDLLLVARGLAGK
LSGGVPPLTVRQLAGPQPFSSEGLGRLVVGDFSDYNNSYVGAFADGHSAYFVFRRRGARA
QAEYRSYVARVCLGDVNLYSYVEVPLACRGQGLVQAAFLAPGTLLGAFAAGPRGAQAALC
AFPLAELDGSMEQARRLCYTAGGRGPSGTEEATVEYGVTSRCVTLPPDSPESYPCGDEHT
PSPIAGRQPLEAEPLLQLGQPVSAVTALQADGHTIAFLGDTQGQLHKVFLNGSQGQVYHS
QQVGPPGSAISPDLLVDSSGSHLYVLTAQQVDRVSVAACPQFPDCTSCLQARDPLCGWCT
LQGRCTRKGQCGRASQPNQWLWSYEEDSHCLHVQSLLPAHHPRQEQGQVTLSVPRLPTLT
MDEYFHCAFGDYDSLAHVEGPHVACVTPPQDQLPLNPPGTDHVTLPLALMFEDVAVAVTN
FSFYDCSAVQALEVAAPCRACVSSLWRCHWCPQSSRCVHGEHCPEGERTIYSAQEVDVQV
RGPGACPWVEGLAGPLLVPVGWESRLALRVWNLQHFRGLPASYHCWLELPGELQRLPASL
EEMPGDAGLIYCQAQQFHPSMAQRELPVPIYVTRGEGQRLDNARTLHVTLYDCAVGHPDC
SHCQAANGSLGCLWCSHGQPTCRYGPLCPPEAVELLCPTPSIDMIEPLTGPPEGGLALTI
LGSNLGRDFADVRDAVSVAGRPCSPNPSLYRTSARIVCVTSPAPDGTVGPIQVAIKSRPP
GISTQHFTYQDPVLLSLNPQWGPQAGGTQLTIHGQHLQTGGNVSAFVGGQPCPIQEPVCP
EAIVCHTAPQASPGEAVVRVVFGHAQRTLLTSPFRYTANPQLLGAEPSVSFRGGGRLIRV
RGTGLNVVQQPLLSVWLETVAEVQAAGAQPWDLTPRRSCGASAAAPQACIQLEGGLLQCS
TVCSANSSSLLLCWSPAVPDGAHPRRVFFTLDNVHVDFASANGGQDFVYQPNPRLAPLSR
EGPTRPYRLKPGNVLDVEGEGLNLGISKEEVRVYIGDSECLVKTLTLTHLYCEPPPRAPQ
PANSSSTLPQFVVQMGNVRLALGPVRYEAEPALSAFPVEAQVGLGVGAAVLTAAVLLLTL
MYRHKSKQALRDYQKVLVQLENLEIGVGDQCRKEFTDLMTEMTDLSSDLEASGIPFLDYR
TYAERVFFPGHGGCPLQPMLEGPGEESHRAPMRQGLTQLSNLLNSKLFLLTLIHTLEEQP
SFSQRDRCHVASLLSLALHSKLEYLTDIMRTLLGDLATHYVHKNPKLMLRRTETMVEKLL
TNWLSICLYAFLREVAGEPLYMLLRAIQYQVDKGPVDAVTGKAKRTLNNSRLLREDVEFR
PLTLMVLVGPGASGAPGGSTAQRVPARVLDTDTITQVKEKVLDQVYKGTPFSQRPSVHAL
DLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGLIPQLHNGGAVSQSL
AQSCPSRENIPMAEDGEEGGVRLWHLVKATEEPEGAKVRRGSLRERERERARAKAIPEIY
LTRLLSMKGTLQKFVDDTFQAILSVNRPVPIAVKYLFDFLDELAEKHGIEDPETLHIWKT
NSLLLRFWVNTLKNPQLIFDVRVSDNVDAILAVIAQTFIDSCTVSEHKVGRILLRHSPEL
SGKLPGDELSSG
Download sequence
Identical sequences XP_014584774.1.31192 XP_014584775.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]