SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014586975.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014586975.1.31192
Domain Number 1 Region: 133-246
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 341-455
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000419
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 544-581
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 254-291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 300-339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 505-542
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014586975.1.31192
Sequence length 859
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MELEWLFRNAQIQVLWVMVVLPVPERDQFVGPGGGQTSADGVSGAQPGLESQAQEPREAD
LSSKPKRERGVPSGPRTTSPRLYMHEETRPAVWAVSSCAPVRAAAPLSPFVSPTVNIVLT
GRLSSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRN
FDVEESHQCSLDWLMLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQ
GFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGS
LCPGGTFPCSGLRSTRCLPAERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDL
FGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSN
HQPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSGDGDAGDPGEQG
CFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPDGADEK
NCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGL
LLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPV
YSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAART
SQTVLGDGLLQPAPGAAPDPPAPRTDTGSPGAAGDGLPSAHCHAPEVGPSVPAPLGLREP
ECGPVDKDRKACRDPLVDSPAPMDTPRELCLAQDPQPPAPTASSTLGPHPPEPLGVCRSP
PPPCSPALEASDDEALLVC
Download sequence
Identical sequences XP_014586975.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]