SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014590180.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014590180.1.31192
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily E set domains 3.78e-17
Family Other IPT/TIG domains 0.00000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014590180.1.31192
Sequence length 924
Comment PREDICTED: exocyst complex component 2 isoform X1 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSPSKI
VCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDR
NKGIPPLSLRPSNPLGIEIEKSKFPQKDLEMLFPGMSADFTSENFSASWYLIENHSTTSF
EQLKTAVTNLKRQASKKSEGSLAYVKGGLSTFFEAQDALSAIHQKLEADGTEKVEGSMTQ
KLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRQLLLDKLLETPSTLHDQKRYIRYL
SDLHAPGDPAWQCIGAQHRWILQLMHSCREGYVHGLQGTPGLHSPMIDLDNDVRPSVLGH
LSQTASLTRGSSFQSSRDDTWRYKTPHRVAFVEKLTKLVLSQLPNFWKLWISYVNGSLFS
ETAERSGQIERSKNVRHRQNDFKKMIQEVMHCLVKLVRGALLPLSISEGGARQHGGWEGK
SELSGQWLAHVIQTMRLTYESLTALEIPNDMLQTIQDLILDLRVRCVMVTLQHTAEEIKR
LAEKEDWIVDNEGLTSLPCQFEQCIVRSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSI
HIMQIFVHCLEQLSAKPDADVDTAHLSMDVSSPDLFGSIHEDISLTSEQRLLIVLSNCCY
LERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIY
AGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVVEAVSEELSRLM
QCVSSFSKNGALQARLEICALRDTVAVHLTSESKSSFKQALEALPQLSSGADKKLLEELL
NKFKSSMHLQLTCFQAAAPPMMKT
Download sequence
Identical sequences F6STY7
9796.ENSECAP00000022990 XP_001488026.1.31192 XP_005603578.1.31192 XP_014590180.1.31192 ENSECAP00000000050 ENSECAP00000022990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]