SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014594455.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014594455.1.31192
Domain Number 1 Region: 28-517
Classification Level Classification E-value
Superfamily Sema domain 6.15e-179
Family Sema domain 0.0000000000701
Further Details:      
 
Domain Number 2 Region: 513-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000279
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 580-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000221
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014594455.1.31192
Sequence length 751
Comment PREDICTED: semaphorin-3C [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MAFRAICVLVGAFVCSLCVKGSTQPQARVYLTFDELRETKTSEYFSLSHQPLDYRILLMD
EDQDRIYVGSKDHVLSLNINNISQEPLSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQ
AFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV
YFFFKEKLTDNSRSTKQIHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPET
HFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPN
HQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSVYPVHRRPLL
VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPSNSSASGELILEELEVF
KNRSPITTMKISSKKQQLYVSSNEGVSQVSLHRCDIYGTACADCCLARDPYCAWDGHACS
RFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQAS
IKWLLQKDKDRRKEVKLNERIIATSQGLLIRAVQDSDQGLYHCIATENSFKQTVAKINLK
VLDSEMVAVVTDKWSPWTWAGSVRALPFHPKDIMGAFSHSEMQMINQYCKDSRQQHQQGE
ESQKMRGDYGKLKALINSRKSRNRRNQLPES
Download sequence
Identical sequences F6T8U8
ENSECAP00000018730 9796.ENSECAP00000018730 XP_008535601.1.77740 XP_008535602.1.77740 XP_014594455.1.31192 ENSECAP00000018730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]