SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014596808.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014596808.1.31192
Domain Number 1 Region: 63-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-24
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 2 Region: 258-364
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 9.03e-20
Family Platelet-derived growth factor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014596808.1.31192
Sequence length 372
Comment PREDICTED: platelet-derived growth factor D, partial [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
SQCTRLILIYTLVCANFCSYRDTSAIPQSASIKALRSANLRRDESNHLTDLYRRDETIQV
TGNGHVQSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEAENDICRYDFVEVED
ISETSTIIRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPAAA
SETNWESVTSSISGVSYHSPSVTDPTLTADALDKTIAEFDTVEDLLKHFNPESWQEDLEN
LYLDTPHYRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLTNVVFFPRCLL
VQRCGGNCGCGTVNWKSCTCNSGKTVKKYHEVLKFEPGHFKRRSRAKHMALVDIQLDHHE
RCDCICSSRPPR
Download sequence
Identical sequences F6SI90
9796.ENSECAP00000022289 ENSECAP00000022289 XP_014596808.1.31192 ENSECAP00000022289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]