SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014596902.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014596902.1.31192
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.14e-19
Family KRAB domain (Kruppel-associated box) 0.00058
Further Details:      
 
Domain Number 8 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-17
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 9 Region: 554-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000161
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 279-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000143
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 363-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000762
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 12 Region: 93-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000475
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014596902.1.31192
Sequence length 603
Comment PREDICTED: zinc finger protein 709-like isoform X2 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MDSVAIEDVSVNFTPEEWALLDPSQKKLYRDVMWETFRHLASVGITWEDCDVEDQYKGQG
RKVRKHRVGRVCESEEDSQFGENFSLLPNLSLNKKTTGAKPWGCSACGRVFMHHSSLKMH
IRCHTERKTYDYQKYEKKPYKCKGCGKAFTYFTLLQAHERTHTREKPYECEKCSKAFTCS
SHLLKHERIHTGEKPYECKTCSKAFTCSSSLQLHERIHTGEKPYECKKCSKAFTCSSHLL
KHERIHTGEKPYECKTCSKAFTSSSNLQLHERIHTGEKPYQCKKCSKAFTCSSHLLKHER
IHTGEKPYECKKCSKAFTSSSHLQRHERIHTGEKPYECKKCSKAFACSSYLQVHERTHTG
EKPYECKTCSKAFTCSSHLRNHERIHTGEKLYECKTCSKAFTSSSNLQKHERIHTGEKPY
ECKTCSKAFTCSSHLLKHERIHTGEKPYECKKCSKAFTCSSHLLKHERIHTGEKPYECKT
CSKAFTCSSHLQRHERIHTGEKPYECKTCSKAFICSSSLQLHKRTHTGEKPYECENCSKA
FTCNSSLRRHERTHSAEKSYECKECNKAFTASKYLRVHLRSHTGEKAYECEESQKGFSSH
ANF
Download sequence
Identical sequences XP_014596902.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]