SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014602707.1.41157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014602707.1.41157
Domain Number 1 Region: 574-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000237
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 317-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000273
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 491-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000131
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 628-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000213
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 545-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000185
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 432-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000381
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014602707.1.41157
Sequence length 1095
Comment PREDICTED: zinc finger protein 845 [Polistes canadensis]; AA=GCF_001313835.1; RF=representative genome; TAX=91411; STAX=91411; NAME=Polistes canadensis; AL=Scaffold; RT=Major
Sequence
MDVTGDLTLQWVEEVGNVIHEEVICGLEAELVASEEEVIGACEEVTVEETGESVSNVPST
TGSEILMVPQNNDMDSIYIVPQDQGHDYLNIQVTEEVIADNWDRSGPDDGVEIPETKVSN
DNLLEYDDMEIPLPIDQDSYTNIRPYPCDFCSRRFRKKANLMNHMVSHQTDRPHHCNLCG
ARYVRKCDLMNHLKTHAYAPSRDGLDDDLNDDDSLAPEEEETNKGRRKKVQSNAPRKRKN
NSTISKRNNDDVKTEMSKYVNKSYDYVDEDMRLLEEMTNRNPVRGNNYPSSSRWNEQISP
VSNEQQPPRWPITDPTKPYVCQYCGVGFAREKALASHARVHGGDSPFECTSCSEMFWDVN
SLREHVRIKHGGTTQLDIEDYDTNDATYTGDERFGEFYCNTCGVPFHRLDLLKRHQKIHV
KQEMDIMEGSSQHHVCNVCGEWFEEALALLAHAELHARSPSRRCLLCGERCRDDAEVAEH
VRLNHAEDAPPNTCTLCGKTCKDKRSLLKHSWVHNVDKTFGCTKCGKRFHSKARLRRHMV
SHRNKMVACDECGEEFPDGRALVSHRHSHNKDLGGRSFPCRECGKTFGSRSSQQIHIRIH
TGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGP
DPKCVGSITPYLCKVCGDAYATSEEIVAHIVQHCDDNTALRRQPQTGPRKYKRRRKLKPH
ETTTMLRINENFDTLEGGSDSDDNTKRKLGRKNKQHRSNVEEGYQNVLKSFESSLQNINS
IVSNSKLNPAKSKLSKKKLRKEEKKNEGQTSCQSGRPKMIHTQKTRVPVEMGSDGVKKGQ
KTKTMVTRTPKVMPSEHKLGIFTGGERNRPRTKNVSYHIEGKLQLTPATFPKLKEENVKL
STQVQPPILTNIKIEPGVQKSVDSNHSNNHSNIVKINSDKLDRTSRKKSTVFKKIKKQKQ
INIKEEPNENVNEVETQNNNNTENTNSIRLMEEHTVDGGSLEVAFEASVVTAEEETILPD
IDTVTTNDNIGNGNVQLSVKVESTPQRILAVHSVITPVDEVAETIIPDTLEYTCEMCSMV
FSSRAELLVHVPIHI
Download sequence
Identical sequences XP_014602706.1.41157 XP_014602707.1.41157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]