SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014637614.1.5094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014637614.1.5094
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily POZ domain 7.85e-23
Family BTB/POZ domain 0.0029
Further Details:      
 
Domain Number 2 Region: 296-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000004
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 334-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000119
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  XP_014637614.1.5094
Domain Number - Region: 272-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000682
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014637614.1.5094
Sequence length 441
Comment PREDICTED: zinc finger and BTB domain-containing protein 26 [Ceratotherium simum simum]; AA=GCF_000283155.1; RF=representative genome; TAX=73337; STAX=9807; NAME=Ceratotherium simum simum; AL=Scaffold; RT=Major
Sequence
MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIVFAAGSPFLRD
QFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFLQMSHIVERCT
QALWKFIKPKQPMDSKEGCEPQSASPQSKEQQGDARGSPKQDSPCIHPSEDSMDMEDSDI
QIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTVENRVSEIEQNHLHNY
ALSYTGSDNIIMASKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMHKLFMC
LLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLHSGDKPHKCNYCD
MVFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSKGCQPQPDATQV
LDAGKLAQAVLNLRNDSTCVN
Download sequence
Identical sequences A0A0D9SEB9 A0A2K5HES2 A0A2K5L0N9 A0A2K5XAP6 A0A2K6B840 A0A2K6NID4 F7H6L3 G1S5W5 G3RGL7 G7PRH4 H2PTB6 H2QXU9 Q9HCK0
ENSP00000362758 ENSP00000362760 9544.ENSMMUP00000000676 9598.ENSPTRP00000036465 9600.ENSPPYP00000021946 9606.ENSP00000362758 ENSMMUP00000000676 ENSPPYP00000021946 ENSNLEP00000020903 gi|18141299|ref|NP_065975.1| ENSMMUP00000000676 ENSMMUP00000039849 NP_001248614.1.72884 NP_001291292.1.87134 NP_001291292.1.92137 NP_001291293.1.87134 NP_001291293.1.92137 NP_065975.1.87134 NP_065975.1.92137 XP_002820230.1.23681 XP_003264153.1.23891 XP_003833185.1.60992 XP_004048625.1.27298 XP_005580888.1.63531 XP_005580889.1.63531 XP_005580890.1.63531 XP_005625454.1.84170 XP_005625455.1.84170 XP_008004533.1.81039 XP_008004534.1.81039 XP_008004536.1.81039 XP_008956897.1.60992 XP_009243122.1.23681 XP_009455523.1.37143 XP_010380772.1.97406 XP_011709597.1.29376 XP_011709598.1.29376 XP_011709599.1.29376 XP_011709600.1.29376 XP_011786803.1.43180 XP_011786805.1.43180 XP_011786806.1.43180 XP_011820881.1.47321 XP_011820882.1.47321 XP_011820883.1.47321 XP_011820884.1.47321 XP_011894635.1.92194 XP_011894636.1.92194 XP_012364274.1.23891 XP_012364275.1.23891 XP_013972556.1.84170 XP_014637614.1.5094 XP_014637615.1.5094 XP_014972345.1.72884 XP_014972346.1.72884 XP_016817098.1.37143 XP_018888529.1.27298 XP_019514341.1.44202 XP_019514342.1.44202 XP_019514343.1.44202 XP_019514344.1.44202 XP_520241.3.37143 ENSPPYP00000021946 ENSP00000362758 ENSNLEP00000020903 ENSGGOP00000014767 ENSPTRP00000036465 ENSGGOP00000014767 ENSPTRP00000036465 ENSP00000362758 ENSP00000362760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]