SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014648330.1.5094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014648330.1.5094
Domain Number 1 Region: 2210-2303
Classification Level Classification E-value
Superfamily C-type lectin-like 3.86e-30
Family Link domain 0.00016
Further Details:      
 
Domain Number 2 Region: 510-648
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-29
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1474-1522,1600-1714
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-28
Family FAS1 domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1715-1869
Classification Level Classification E-value
Superfamily FAS1 domain 1.1e-25
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 5 Region: 966-1123
Classification Level Classification E-value
Superfamily FAS1 domain 4.19e-23
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 6 Region: 386-502
Classification Level Classification E-value
Superfamily FAS1 domain 2.62e-20
Family FAS1 domain 0.0058
Further Details:      
 
Domain Number 7 Region: 2301-2464
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-17
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 8 Region: 1132-1255
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000523
Family FAS1 domain 0.0093
Further Details:      
 
Domain Number 9 Region: 1546-1583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000167
Family Merozoite surface protein 1 (MSP-1) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014648330.1.5094
Sequence length 2573
Comment PREDICTED: stabilin-1 isoform X1 [Ceratotherium simum simum]; AA=GCF_000283155.1; RF=representative genome; TAX=73337; STAX=9807; NAME=Ceratotherium simum simum; AL=Scaffold; RT=Major
Sequence
MAGPRGLLLLCLLAFCLAGSSFVRGQKVRSRRCDVKTKFVTHMPCTMCPVAKKQTCPPGW
LREFPGKISQDCRYEVQLGDSLVSMSGCSLECWKDVVQKACCPGYWGSECYECPGEAKTP
CNGHGTCLDGIDRNGTCVCQENFSGSACQECQDPNRFGPDCQSVCSCVHGVCSHGPLGDG
SCLCFAGYTGPHCDQELPVCQALRCPQNSQCSAEAPTCRCLPGYTQQGSECQAPDPCQPS
PCSPLAQCSVSPRGQAECRCPENYHGDGTMCLPQDPCTTNHGGCPSNTTLCLYQRPGKAS
CSCKPGMVSINHNASAGCFAYCFPNACDRSATCQVTPDGKTSCVCKEGEVGDGRACYGHL
LHEVQKAGQTSMMFLRLRVALTMLDQGCREILTTSGPFTVLVPSISSILSRNINASLAQQ
LCKQHIIAGQHILEELGTQYTHRWWTLAGQEITVTFNRFVRKYTYKYKDQPQQTFTIHKA
NYPAANGVFHVVTALRWQPPTELPEEPKRTISQILASTEAFSRFETILENCGLPSILDGP
GPFTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYSHGQLTVEKLISKGRVLTM
ANQVLAVNISEEGRILLGPEGVPLRRVDVLAANGVIHLLEGILLPPTILPILPKHCSEEQ
HKIVAGSCVDCQVLNTSTCPSNSVTLDIFPKECVYTYDPSGLNVLRKGCARYCNQTILKP
GCCKGFFGPDCAQCPGGFSNPCYGKGNCSDGVRGNGACLCFPDYKGIACHICSNPNKHGD
QCQEDCGCVHGLCDNRPGSGGVCQRDTCAPGFGGRFCNESTGSCGPSEWAQHCHLHARCV
SQGGVARCLCLDGFEGDGFSCTPSNPCSHPDRGSCSENAECVPGALGTHHCTCHKGWSGD
GRVCVAIDECELDARGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDPCRAGNGGC
HDLATCRAVGGGQRVCTCPSGYEGDGLSCYGDIFQELEANAHFSVFYQWIKSAGITLPAA
SRVTALVPSESAIRRLSPEDQAFWLQPRMLPQLVRAHFLQGALSEEELARLGGQDVATLS
PTTRWEIHNISGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRRAVLVGQGLLQQLDSV
PAFRLFRELLQHHRLVPQIEAATAYTIFVPTNHSLEVQGNISSLDADTVRHHVVLGEALS
MEALQRGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPLLEAPGRSLFGLSGVLTVGSS
RCLHSHAEALREKCTNCTRKFRCTQGFKLEDTPKKSCVYRSGYSFSRGCSYTCAKKIQVP
DCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCQEGFHGTACEMCELGRYGPN
CTGVCDCAHGLCQEGLRGDGSCVCNVGWQGLRCDQKITGPQCPKKCDPNANCVQDSAAAP
ACVCAAGYSGNGIYCSEVDPCAHDHGGCSPHANCTKVAPGQRTCTCQDGYTGDGELCQEI
NSCLIHHGGCHLHAECIPTGPQQVSCSCREGYSGDGIRTCKLLDPCSQNNGGCSPYAMCK
STGDGQRTCTCDAAHTVGDGFTCRARVGLELLRDRHASFFSLHLLEYKELKGDGPFTIFV
PHADLMTNLSQDELARIRAHRQLVFRYHVVGCRQLRSQELLEEGYVTTLSGHPLRFSEKE
GSIYLNDYARVVSSDQQAVNGVLHFIDRVLLPPDALHWEPDAAPIPRRNVTAAAESFGYK
IFSSLVTVAGLLPLLRDASHRPLTMLWPTDSALRALPPDRQAWLYHEDHREKLAAILRGH
VIRNIEALASDLPNLGPLRTMHGTPISFSCSRARPGELTVGEDDAHIVQRHLPFEGGLAY
GIDQLLEPPGLGARCDRFETRPLYLKICSICGLEPPCPEGSQEQGSPEACWRYYSKFWTS
PPLHSLALRSIWARPSLWGQPQGLGRGCHRNCVTTTWKPSCCPGHYGSECRACPGGASSP
CSDHGMCVDGMSGSGQCRCRSGFAGTACELCAPGAFGPHCQACRCTSHGRCDEGLGGSGS
CFCDEGWTGPHCEVQLELQPVCAPPCAPQAVCRAGNSCECSLGYEGDGRTCTVADLCQDG
RGGCSEHANCSQVGTVVTCTCLPDYEGDGWSCRARDPCADGHRGGCSEHADCLNTGPNTR
RCVCHTGYVGDGLQCLEELEPPVDRCLGQPPPCHVDAVCTDLHFQEKRAGVFHLQATSGP
YGLNFSEAEAACGAQGAVLASLLQLSAAQQLGFHLCLVGWLANGSAAHPVVFPAADCGDG
QVGVVSLGARKDLSECWDAYCYRVQDVSCHCRDGFVGDGTSVCNGKLLDILATTANFSTF
YGMLLGYANATPRGLDFLDFLDDELTYKTLFVPVNEGFMDNMTLSGPDLELHASNTTFLS
TNASQGTLLPTHSGLCLIISDVGPDNSSWAPVAPGAVVVSRVIVWDIMAFNGIIHTLASP
LLAPPQPRALAAPEAPPVAVGAGAVVAAGALLGLVAGALYLRARGKATGFGFSAFQAEGD
ADDDFSPWQEGTSPTLVSVPNPVFGSHDTFCEPFDDSLLEEDFPDTQRILAVK
Download sequence
Identical sequences XP_014648330.1.5094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]