SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014649487.1.5094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014649487.1.5094
Domain Number 1 Region: 232-487
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.27e-64
Family Eukaryotic proteases 0.000000123
Further Details:      
 
Domain Number 2 Region: 51-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-23
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 194-240
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000256
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014649487.1.5094
Sequence length 491
Comment PREDICTED: complement C1r subcomponent-like protein isoform X1 [Ceratotherium simum simum]; AA=GCF_000283155.1; RF=representative genome; TAX=73337; STAX=9807; NAME=Ceratotherium simum simum; AL=Scaffold; RT=Major
Sequence
MSGSRCLISEWGNCLWGSPHSTSCPGKMWWLLLWGVVQACPTQGSVLLAQQLPQKLTSPG
YPDLYVKGQEISIDIKAPEGFAVRLVFQDFDLEPSQDCEQDSVTITASGMDPSRFCGQQG
SPLGSPPGQREFVSSGSSLRLTFRAPASSEDRTTHLHRGFLALYQAVGMNHSQPISPASG
GSEATHTPEDNPSKFQNHCQEPYYQVVPAGTLSCTARGPWQETQDRREVPHCVPVCGQPV
TPIAQDQEALGSSRAKSGNFPWQALTSIYGRGGGALLGDRWILTAAHTIYPKDSISPRKN
RRVDVFLGHTNVDEMLELGNHPVRRVVVHPDYRQNESHNFTGDIALLELQHSVPLGPSLL
PVCLPDSETLYRSGLWGYVSGFGVERGWLTTELKYARLPVAPREACKAWLQEKQRTEVFS
DSMFCVGDKMRPQSVCQGDSGGVYVVWDDRARHWVATGIVSWGIGCDKGYGFYTKVLNYV
DWIKEVMDGKD
Download sequence
Identical sequences XP_014649487.1.5094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]