SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014652356.1.5094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014652356.1.5094
Domain Number 1 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-24
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-23
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 11-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-18
Family KRAB domain (Kruppel-associated box) 0.00071
Further Details:      
 
Domain Number 5 Region: 484-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.53e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 6 Region: 145-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 318-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 237-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.25e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 600-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-16
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 10 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000065
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 11 Region: 89-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000147
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 194-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000209
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014652356.1.5094
Sequence length 671
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 709-like [Ceratotherium simum simum]; AA=GCF_000283155.1; RF=representative genome; TAX=73337; STAX=9807; NAME=Ceratotherium simum simum; AL=Scaffold; RT=Major
Sequence
MLGDPRNLEMNSVAIEDVAVNFTPEEWAVLDPSQKKLYRDVIWETCRNLASVGKTXEDHE
IEDXVKNQGRKLRSRIVKRLCESEEGSQCGENVIHFPNLNLNKKTTGVKPHECSACGRVF
MHHSSLNMHVRCHTGHKPYDYQKVGEKQYKCKECGKAFINPSRPRSCMIFHTGGGPYKCK
ECDKVFISPSAFXIHERSHTGEKPYERKKCSKALSFPSSLQRHERSHTGEKAYEYAPYKC
KECEKGFNCSSSLQVHERTHTGEKPYECAKCTKTFSCPSSLQRHEKTHTGKKPYECKECG
KAYRYYTSLQTHERTHTGEKPYKCKQCGKAFISHLGFQIHERNHNGEKQYECKKCSKAFS
CPSSLQKHEKNHTGEKPYECRKCSKAFSFPSSLQVHERTHTGEKPYKCKECGKAFTALSS
LRAHMISHTGDGPYKCKECEKAFISPSAFQIHQRIHTGEKPYECKQCGKAFSYITSFQIH
KRTHTGEKPYECKECGKAFSVATSLRIHEKTHSIEKPYHCKQCGKAFRYHHNFQRHERSH
IGEKLYECKQCSKTFSYYNSFQIRKRSHTGEEPCECETCTTAFTCPGSLQKHERSHTREK
THECKECGKTFICHTNFQRHVRVHTGEKPYKCVECGKAFCDSSSFRRHERTHWIKPLEGK
QCGKGFNWPTS
Download sequence
Identical sequences XP_014652356.1.5094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]