SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014657277.1.33630 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014657277.1.33630
Domain Number 1 Region: 187-278,305-371
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000458
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014657277.1.33630
Sequence length 798
Comment conserved hypothetical protein [Moesziomyces antarcticus]; AA=GCF_000747765.1; RF=representative genome; TAX=84753; STAX=84753; NAME=Moesziomyces antarcticus; strain=JCM 10317; AL=Scaffold; RT=Major
Sequence
MIAQVSITHPSLRPASSLDNSSDSPPAPHRQQRPSPAMSGSSFFSQISSFFGASPNSNSR
SGARHSSPFSSGLPSSSRRGPPQALDANAWSLPYSSRSSIPASPAYPTDAPNSATDGHYP
PAAGIARASSPYAHDHPPISTSSVAEFSNMYPTASTSTLVPGTAANTLSVSAGGSVPTTA
YPPMRHTWNRIRKWCRKNYPEMSDTLNWPCTEDALDELEMTIGYALPSAVRESYLVYDGQ
ELESNQSCQDGLFFGAALLSLEQIAEEWKFWRAVDEDPETAANPHVRNLMASCPHKWIRP
EYSCRGWIPLITDHAGNYIGIDLSPHPAGAGSPGQVIIFGRDFDTKVVCWKGEGAGGWGR
FLQSFADELDAGEFWTLEELTSASEDEEDVIGYQSYFSGGGAGAGQGGGDRGGEGAAAFR
LQGQYKGWPVLEAWADRSVRLWESVGLAPGKPVGNAQQPAQPQPQSVVNRQSQLFGDDTG
IPPSVQAVNENGEAIDAEGSGSQRPAIAVGKELAGQVSVDGPAHPLADASLAGDTSAEVL
IAPADSTLATDATTVTVDTQAADAKEADGSVDVNLTPTNSTRRVSGMLSPPLPETKASLR
KQKQREEGWGSPMLNQSVAMGQQPRRPVRPAPAPAATLDLPTIEDVKAIQAAALADDGKS
HNVQFDSHPQARSSFTNLGFRDLAGKIGAPGMGLGGGSNGNAVGSPQQRSESVELETRSS
VENRSANSYIVGQRGRARGLGLEAGEDEAAAEAFGAMSVSAAKTREMPSLIDASSAPGSP
LVRGTPKLSEAEVPAALA
Download sequence
Identical sequences A0A081CCE1
XP_014657277.1.33630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]